DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsf3 and Srprb

Sequence 1:NP_523759.1 Gene:Tsf3 FlyBaseID:FBgn0034094 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_033301.1 Gene:Srprb MGIID:102964 Length:269 Species:Mus musculus

Alignment Length:87 Identity:23/88 (26%)
Similarity:37/88 (42%) Gaps:13/88 (15%)


  Fly   629 SETRPFTLYGIFDKRNNVLFRDDTDG--LLGLQELHR-DNAKRVMEHIYDRYANTQ--------Y 682
            |.|....:|.:.:.|.|.|...|..|  .|..|.|.| .::.|.:..:.|..|..:        .
Mouse    93 SITDSSAIYKVNNNRGNSLTLIDLPGHESLRFQLLDRFKSSARAVVFVVDSAAFQREVKDVAEFL 157

  Fly   683 YRNFDESGAMKSSHNLWILLVC 704
            |:...:|.|:|:|.:|  |:.|
Mouse   158 YQVLIDSMALKNSPSL--LIAC 177

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsf3NP_523759.1 PBP2_transferrin 33..368 CDD:270247
PBP2_transferrin 369..681 CDD:270247 15/55 (27%)
TR_FER 370..656 CDD:214514 8/29 (28%)
SrprbNP_033301.1 SRPRB 60..239 CDD:255367 23/88 (26%)
SR_beta 63..268 CDD:206691 23/88 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11485
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.