DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsf3 and Ltf

Sequence 1:NP_523759.1 Gene:Tsf3 FlyBaseID:FBgn0034094 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_032548.2 Gene:Ltf MGIID:96837 Length:707 Species:Mus musculus

Alignment Length:751 Identity:167/752 (22%)
Similarity:274/752 (36%) Gaps:181/752 (24%)


  Fly    32 LRVCVVESRGVYRKTPKFCPLLEAKSNIE---CV--------IGVDRLDCVRRIHKGTAHFGVLT 85
            |.:|:.::     .|.::|    |.||.|   |:        :|...|.||::.........::|
Mouse    14 LGLCLAKA-----TTVQWC----AVSNSEEEKCLRWQNEMRKVGGPPLSCVKKSSTRQCIQAIVT 69

  Fly    86 SE-DLVA---------------ARWASVEILVASEL-RSHESHFEYEIVAVVDNHANIHTVHDLR 133
            :. |.:.               .|..:.|:....|. |:|     |..||||.|.:|.| ::.|:
Mouse    70 NRADAMTLDGGTMFDAGKPPYKLRPVAAEVYGTKEQPRTH-----YYAVAVVKNSSNFH-LNQLQ 128

  Fly   134 GARLCHPGYGLGNHW---TEVLANYFEAAMVSKTCDPEMTVTEDRIASTAKYFGPSCKAGPWVPD 195
            |.|.||.|.|....|   ...|..|.      ....|..::.|    :.:|:|..||     ||.
Mouse   129 GLRSCHTGIGRSAGWKIPIGTLRPYL------NWNGPPASLEE----AVSKFFSKSC-----VPG 178

  Fly   196 PKQDRILKNRYPSLCEMC--YEPDSCDQT--DKHWGRRGALYCLTSGGGNVAWARLDDVRSHFGF 256
            .::|     |:|:||..|  ...:.|..:  :.:.|..|||.||....|:||:.|...|     |
Mouse   179 AQKD-----RFPNLCSSCAGTGANKCASSPEEPYSGYAGALRCLRDNAGDVAFTRGSTV-----F 233

  Fly   257 SGIPAQSNPSDFSYLCPDGHLQPLNASQPCVWVAKPWPVVAARRSHAAQV--------------Q 307
            ..:|.::....:..||||...:|:...:.|.....|...|.:|.::..:.              :
Mouse   234 EELPNKAERDQYKLLCPDNTWKPVTEYKECHLAQVPSHAVVSRSTNDKEEAIWELLRQSQEKFGK 298

  Fly   308 RLVTGLNHDEPDSWQNALLSLLETYHVFTVPLDNVIAIDDYLDQATAFQSAYSFPECNPPRS--- 369
            :..:|.......|.|..||..........||  ..:.:..||    .|....|....|..:.   
Mouse   299 KQASGFQLFASPSGQKDLLFKESAIGFVRVP--QKVDVGLYL----TFSYTTSIQNLNKKQQDVI 357

  Fly   370 -----IVFCTTSIIQHIKCSWLQEASQVYGVQPNIQCVRTMDEQQCLDNTKFKETDVVLVDQEMR 429
                 :.:|.....:..||.....||     :..:.|:.....:.|:......:.|.:.:|....
Mouse   358 ASKARVTWCAVGSEEKRKCDQWNRAS-----RGRVTCISFPTTEDCIVAIMKGDADAMSLDGGYI 417

  Fly   430 VKAQRDYNLVPLLYE-------FAADMHDR----YVTIALVHK-DAKFESFRDLKGARACLPSFE 482
            ..|.: ..|||:|.|       ...|..:|    |:.:|.|.: ||.| ::..|:|.::|     
Mouse   418 YTAGK-CGLVPVLAENQKSSKSNGLDCVNRPVEGYLAVAAVRREDAGF-TWSSLRGKKSC----- 475

  Fly   483 GAAHLSVQET---------IVNATGKVQSLHSYFHRDS-------------CLWNLQSGRKCPLH 525
               |.:|..|         :.|.|...: .:.:|.:..             |:.:.:...||..:
Mouse   476 ---HTAVDRTAGWNIPMGLLANQTRSCK-FNEFFSQSCAPGADPKSNLCALCIGDEKGENKCAPN 536

  Fly   526 ----YQGDEGALRCLSEGA-DVAFLSSDVYKKYVVGNLTSNWLTPGNHKDFRVLCPYGGIEKRSN 585
                |||..||||||:|.| :||||......:...|..|..|......|||.:||.....:..:.
Mouse   537 SKERYQGYTGALRCLAEKAGNVAFLKDSTVLQNTDGKNTEEWARNLKLKDFELLCLDDTRKPVTE 601

  Fly   586 FEYCYLHWTTRGHLMTHNSSLTRRNE----IYNSLRDMDQLFGRKYKSETRPFTLYGIFDKRNNV 646
            .:.|:|       .:..|.::..|.:    :...|.|....|||..:.....|.|:.  .|..|:
Mouse   602 AKNCHL-------AIAPNHAVVSRTDKVEVLQQVLLDQQVQFGRNGQRCPGEFCLFQ--SKTKNL 657

  Fly   647 LFRDDTDGLLGLQELHRDNAKRVMEHIYDRYANTQY 682
            ||.|:|:.|          ||...:...::|...:|
Mouse   658 LFNDNTECL----------AKIPGKTTSEKYLGKEY 683

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsf3NP_523759.1 PBP2_transferrin 33..368 CDD:270247 86/384 (22%)
PBP2_transferrin 369..681 CDD:270247 79/363 (22%)
TR_FER 370..656 CDD:214514 76/329 (23%)
LtfNP_032548.2 PBP2_transferrin_N 23..349 CDD:270336 84/367 (23%)
Transferrin 24..351 CDD:278817 84/368 (23%)
PBP2_transferrin_C 361..691 CDD:270335 80/359 (22%)
TR_FER 363..692 CDD:214514 80/357 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28KI0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11485
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.880

Return to query results.
Submit another query.