DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsf3 and LOC100498607

Sequence 1:NP_523759.1 Gene:Tsf3 FlyBaseID:FBgn0034094 Length:714 Species:Drosophila melanogaster
Sequence 2:XP_002931966.2 Gene:LOC100498607 ID: Length:749 Species:Xenopus tropicalis

Alignment Length:825 Identity:183/826 (22%)
Similarity:285/826 (35%) Gaps:225/826 (27%)


  Fly     1 MQWLTLILVGLFASFLSISMCVAVQPPDDGKLRVCV---VESR---GVYRKTPKFCPLLEAKSNI 59
            :.:.||:...:|  ||   :.:....|...|.|.|.   :|.|   .:.|......|...|.|.:
 Frog     3 LAFCTLLSTNVF--FL---LFMLPHTPSGKKFRWCTLSDLEQRKCSHLARTLQTILPASHAFSRV 62

  Fly    60 ECVIGVDRLDCVRRIHKGTAHFGVLTSEDLVAARWASVEILVASELRSHESHFEYEIVAVVDNHA 124
            .||......||:.:|....|....|.:.|:..| ....::.|.::.|..:....|.:........
 Frog    63 SCVRAHTTQDCMSKIRGNKADAVSLDAGDVYTA-IKQYDLAVVAKERHSDGSCVYAVAVARRGTL 126

  Fly   125 NIHTVHDLRGARLCHPGYGLGNHW--------TEVLANYFEAAMVSKTCDPEMTVTEDRIASTAK 181
            ||   |.|...|.||.|....:.|        ::.|.::.|...:||.              .:.
 Frog   127 NI---HKLNRTRSCHNGARWTSGWNIPFGFFLSKNLLHWDEEQPLSKV--------------VSA 174

  Fly   182 YFGPSCKAGPWVPDPKQDRILKNRYPSLCEMCYEPDS--------CD--QTDKHWGRRGALYCLT 236
            ||..||..|..:..           |:|||:|....|        |:  ..:......||..||.
 Frog   175 YFNASCIPGIGIAS-----------PNLCELCQGSKSYVRDRNNFCEISSNEPFADSDGAFRCLK 228

  Fly   237 SGGGNVAWARLDDVRSHFGFSGIPAQSNPSDFSYLCPDGHLQPLNASQPCVWVAKPWPVVAARRS 301
            :|||:||:      ..|.... .|.:|...:|..|||||....|::.|.|.....|...:.. |.
 Frog   229 NGGGDVAF------MDHLAIM-TPTESEMQEFELLCPDGSTANLSSFQYCNLGQGPGKAIVT-RG 285

  Fly   302 HAAQVQR--LVT-----GLNHDE----------PDSWQNALLSLLETYHVFTVPL---------D 340
            |..:|.:  ||.     ||...|          |...||.:      :|..|:.|         .
 Frog   286 HLHRVTKRFLVLIQDLFGLKRKEKRRFSLFSSLPFGGQNLM------FHDSTLELQILGNEADVS 344

  Fly   341 NVIAIDDYLDQATAFQSAYSFPECNPPRSIV-FCTTSIIQHIKC-SWLQEASQVYGVQPNIQCVR 403
            :|:.: ||:    |..........:...|:: :|..|..:..|| .|......    .| :.|:.
 Frog   345 SVLGM-DYV----ALLKGLGHEGISLDHSVIRWCCISTAELQKCEDWAMNVKS----DP-LVCIL 399

  Fly   404 TMDEQQCLDNTKFKETDVVLVDQEMRVKAQRDYNLVPLLYEFAADMH----DRY----------- 453
            |.....|::..|..|.|.|.:|......|.: ..|.|...|:...:.    |.|           
 Frog   400 TTSLTGCIEMIKRNEADAVSLDATHAYIAAK-CGLQPAAVEYWGHVSECPTDPYQMPLNITEKGF 463

  Fly   454 ---VTIALVHKDAKFESFRDLKGARAC---LPSFEGAAHLSVQETI-----------VNATGKVQ 501
               ..:|:..|..:..|...:...|:|   :.|..|...|| :.|:           :|:..|  
 Frog   464 PTLFALAVTKKSNRAVSLSGMSSRRSCHGNIYSVAGWLLLS-KYTVRGNKNDTWDCDINSAYK-- 525

  Fly   502 SLHSYFHRDSCL-------------W---NLQSGRKCPLH---YQGDEGALRCL---SEG---AD 541
               :||.: .|:             |   :...||....|   |.|:.||||||   .||   .|
 Frog   526 ---NYFWK-GCMPGAEHNLCKVCIGWEEGDRLMGRCTANHKERYYGNPGALRCLVGDPEGRSFGD 586

  Fly   542 VAFLSSDVYKKYVVGNLTSNWLTPGNHKDFRVLCPYGGIEKRSNFEYCYLHWTTRGHLMTHNSSL 606
            ||||......:.:....:|.|....:..||.:|||.......:::..|.|.......:|| ...:
 Frog   587 VAFLEHHSLLENIENLESSGWAHGFSASDFELLCPDESRAALTDWHNCNLGTVPPNVVMT-RPII 650

  Fly   607 TRRNEIYN-SLRDMD----------QLF-GRKYKSETRPFTLYGIFDKRNNVLFRDDTDGL---- 655
            |.:  ||: .::..|          ||| .||         :||    ..::||:|.|..|    
 Frog   651 TAK--IYDFIIKSQDGLRPEKGSDFQLFQSRK---------IYG----EGDLLFKDSTTCLLPAS 700

  Fly   656 -LGLQELHRDNAKRVMEHIY-----------------DRYANTQY 682
             |.||||..::..::.:.::                 |...:|||
 Frog   701 HLRLQELLGESFIQLADSVFKCTQSAILDFCKTDICADPINSTQY 745

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsf3NP_523759.1 PBP2_transferrin 33..368 CDD:270247 85/385 (22%)
PBP2_transferrin 369..681 CDD:270247 89/405 (22%)
TR_FER 370..656 CDD:214514 81/362 (22%)
LOC100498607XP_002931966.2 TR_FER 30..358 CDD:214514 85/376 (23%)
Periplasmic_Binding_Protein_Type_2 30..358 CDD:304360 85/376 (23%)
Periplasmic_Binding_Protein_Type_2 370..718 CDD:304360 86/377 (23%)
TR_FER 370..713 CDD:214514 86/372 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.