DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsf3 and depdc5

Sequence 1:NP_523759.1 Gene:Tsf3 FlyBaseID:FBgn0034094 Length:714 Species:Drosophila melanogaster
Sequence 2:XP_012825109.1 Gene:depdc5 XenbaseID:XB-GENE-980707 Length:1633 Species:Xenopus tropicalis

Alignment Length:278 Identity:59/279 (21%)
Similarity:90/279 (32%) Gaps:97/279 (35%)


  Fly   148 WTEVLANYFEAAMVSKTCDPEMTVTE-----------------DRIASTAKYFGPSCKAGPWVPD 195
            :|.....:||.|:|    :.|:..:|                 .|.:|.::.||...:|.     
 Frog  1318 FTAFQRKWFEVALV----EEELLHSEIPPFLLPWLPSRPASYASRHSSFSRSFGGRSQAA----- 1373

  Fly   196 PKQDRILKNRYPSLCEMCYEPDSCDQTDK-HWGRRGALYCLTSGGGNVAWARLDDVRSHF----- 254
                .:|....|....:..:.|..::||: .|       |.:...||.:.....:::.|:     
 Frog  1374 ----ALLAATVPEQRTVTLDVDVNNRTDRLEW-------CSSYYHGNFSLTAAFEIKLHWMAATA 1427

  Fly   255 -----------------GFSGIPAQSNPSDF-SYLCPDG-HLQ---PLNASQPCVWVAKPWPVVA 297
                             ||..:|....|... |||..|. ..|   |||.|  |        :|.
 Frog  1428 AMLFEMVQGWHRKAPSCGFLLVPVVEGPFSLPSYLYGDPLRAQLFIPLNIS--C--------LVK 1482

  Fly   298 ARRSHAAQVQRLVTGLNHDEPDS-WQNALLSLLETYHVFTVPLDNVIAIDDYLDQATAFQSAYSF 361
            |...|      |..|.   ||:: |:...|            |..|||......|.....||::|
 Frog  1483 AENDH------LFEGF---EPETYWERMYL------------LQEVIAYRFGFIQDKYSASAFNF 1526

  Fly   362 PECNPPRSIVFCTTSIIQ 379
            |..|.|:.|....|..:|
 Frog  1527 PSENKPQYIHVTGTVFLQ 1544

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsf3NP_523759.1 PBP2_transferrin 33..368 CDD:270247 56/266 (21%)
PBP2_transferrin 369..681 CDD:270247 3/12 (25%)
TR_FER 370..656 CDD:214514 3/11 (27%)
depdc5XP_012825109.1 DUF3608 132..407 CDD:289061
YkfC <305..428 CDD:225881
DEP_DEPDC5-like 1209..1292 CDD:239896
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.