DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsf3 and meltf

Sequence 1:NP_523759.1 Gene:Tsf3 FlyBaseID:FBgn0034094 Length:714 Species:Drosophila melanogaster
Sequence 2:XP_002937877.2 Gene:meltf XenbaseID:XB-GENE-968181 Length:723 Species:Xenopus tropicalis

Alignment Length:793 Identity:180/794 (23%)
Similarity:310/794 (39%) Gaps:158/794 (20%)


  Fly     1 MQWLTLILVGLFASFL---SISMCVAVQPPDDGKLRVCVVESRGVYRKTPKFCPLLEAKSNIECV 62
            |.|..:.::..|.:.|   .:..| .:..|::.|..    :.:..:.:. |..|:|      .||
 Frog     1 MIWKIVFILFYFHTILCLNEVRWC-TISDPENKKCN----DMKAAFGQA-KITPML------SCV 53

  Fly    63 IGVDRLDCVRRIHKGTAHFGVLTSEDLVAARWASVEIL-VASELRSHESHFEYEIVAVVDNHANI 126
            .|...:||.|.|....|....|..| |:....:...:. ||.|:........|..||||..::: 
 Frog    54 NGKSGMDCARMIMNNEADAVTLNGE-LIYQAGSQYNLKPVAGEVYDQGMGTSYYAVAVVRKNSS- 116

  Fly   127 HTVHDLRGARLCHPGYGLGNHWTEVLANYFEAAMVS-KTCDPEMTVTEDRIASTAKYFGPSCKAG 190
            :|:::|:||:.||.|:.....|...:....::..:: ..|:.:..|        :.:|..||..|
 Frog   117 YTINNLKGAKSCHTGFQRTAGWNVPIGYLIDSGRIAVVACNIQKAV--------SSFFSQSCVPG 173

  Fly   191 PWVPDPKQDRILKNRYPSLCEMCY----EPDSCDQTDKHWGRRGALYCLTSGGGNVAWARLDDVR 251
            ....|             ||::|.    ..:.||...::....||..||..|.|:||:.:...|.
 Frog   174 STQAD-------------LCQLCIGDANGTNVCDLNGRYSDYSGAFRCLVEGQGDVAFIKHSTVA 225

  Fly   252 SHFGFSGIPAQSN---PSDFSYLCPDGHLQPLNASQPCVWVAKPWPVVAAR-RSHAAQVQRLV-- 310
            .:.......:.:.   .||:..||.||....::..:.|.....|...|..| .:..:.:.:::  
 Frog   226 ENSDGKNTDSWAREVISSDYQLLCRDGSHADISEWRQCNLARVPAHAVMTRTNTDGSLIYKMLQD 290

  Fly   311 ---------TGLNHDEPDSW-QNALL----------SLLETYHVFTVPLDNVIAIDDYLDQATAF 355
                     :|....:..:: .|.||          :..:||..:..        ||||      
 Frog   291 GQQKYNIHSSGFRMFDSSAYNSNNLLFRDMTTELRATGNQTYQAWLG--------DDYL------ 341

  Fly   356 QSAYSFPECNP---PRSIVFCTTSIIQHIKCSWLQEASQVYGVQPNIQCVRTMDEQQCLDNTKFK 417
             .|.....|:|   |:|:.:||.|..:..||:.:....:...:.|::|||.....:.|::..:.|
 Frog   342 -QAMKGINCDPDKLPKSLRWCTLSTPEIWKCADMARVFKDKNLDPSLQCVSADSPEACMELIRQK 405

  Fly   418 ETDVVLVDQEMRVKAQRDYNLVPLLYEF--AADMHDRYVTIALVHKDAKFESF--RDLKGARACL 478
            |.|.|.:|.....||.:.|.|||...|.  ..::...|..:|||.:| ...:|  .||||.::|.
 Frog   406 EVDAVTLDGGDVYKAGKTYGLVPAAGESYPETNLSSSYYAVALVRRD-PLNAFTIHDLKGKKSCH 469

  Fly   479 PSFEGAAHLSVQETIVNATGKVQSLH----------SYFHRDSC------------LWNLQSG-- 519
            ..:|..|..:|.   :.|..|:.|:.          :.|...||            |..|..|  
 Frog   470 TGYERTAGWNVP---IGALIKLGSIRPDECNTAKAVANFFSGSCVPGANQKNFPPELCKLCKGDS 531

  Fly   520 ---RKCPL----HYQGDEGALRCLSEGA-DVAFLSSDVYKKYVVGNLTSNWLTPGNHKDFRVLCP 576
               .||..    .|.|..||.|||:|.| ||||:......:...|..|.:|.......||::|||
 Frog   532 KGQNKCEKDTREQYFGYSGAFRCLAEKAGDVAFVKHATVFELTDGQSTESWAKNLKSSDFQLLCP 596

  Fly   577 YGGIEKRSNFEYCYLHWT-TRGH-LMTHNSSLTRRNEIYNSLRDMDQLFGRKYKSETRPFTLYGI 639
            .|...:.|.:..|  :|. ...| :|.|..  |..:.:|..|.:..:.:|....|:      :.:
 Frog   597 NGARAEVSQYPDC--NWAQVPAHAVMVHPD--TNIHAVYGLLANAQEYYGNDNSSQ------FKM 651

  Fly   640 FD----KRNNVLFRDDTDGLLGLQELHRDNAKRVMEHIYDRYANTQYYRNFD----ESGAMKSSH 696
            ||    ..|:::|:|.|..::.:||          :..|.::..:.|..:.:    .|.|.|...
 Frog   652 FDSSSYNANDLIFKDSTYKIVPVQE----------KKTYSQWLGSGYLESLEGMQCSSSAAKLRV 706

  Fly   697 NLWILLVCLLFVV 709
            |:..||:..|.::
 Frog   707 NITFLLISALLLI 719

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsf3NP_523759.1 PBP2_transferrin 33..368 CDD:270247 75/370 (20%)
PBP2_transferrin 369..681 CDD:270247 90/354 (25%)
TR_FER 370..656 CDD:214514 86/328 (26%)
meltfXP_002937877.2 TR_FER 21..348 CDD:214514 75/377 (20%)
PBP2_transferrin 21..347 CDD:270247 75/376 (20%)
PBP2_transferrin 357..696 CDD:270247 91/363 (25%)
TR_FER 359..695 CDD:214514 90/360 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28KI0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.780

Return to query results.
Submit another query.