DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsf3 and zgc:172271

Sequence 1:NP_523759.1 Gene:Tsf3 FlyBaseID:FBgn0034094 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_001107938.1 Gene:zgc:172271 ZFINID:ZDB-GENE-080204-110 Length:733 Species:Danio rerio

Alignment Length:739 Identity:164/740 (22%)
Similarity:267/740 (36%) Gaps:174/740 (24%)


  Fly    32 LRVCVVESRGVYRKTPKFCPLLEAK-----------------------SNIECVIGVDRLDCVRR 73
            |.:|.:.|.|   |..::|.:.||:                       :.:.||......||:.:
Zfish    13 LLLCSITSWG---KKMRWCAVSEAEQKKCAELAKALVAVLPPAAVTAFARLSCVKAYSTADCINK 74

  Fly    74 IHKGTAHFGVLTSEDLVAARWASVEILVASELRSHESHFEYE------IVAVVDNHANIHTVHDL 132
            |....|....|.:.::.:|.......:||.|:        |.      .||||.|.::: .:..|
Zfish    75 IRDNKADLVTLDAGEVYSAVKQFGLTVVAKEI--------YRDGGCILAVAVVRNSSSL-DMRSL 130

  Fly   133 RGARLCHPGYGLGNHWTEVLANYFEAAMVSKTCDPEMTVTEDRIASTA--KYFGPSCKAGPWVPD 195
            :|:|.||.|......|:..|.:     ::|:...|   ..||...|.|  .:|..||..|     
Zfish   131 QGSRSCHSGARWTAGWSLPLGH-----LLSRNLLP---WAEDEPISQAVSAFFNASCVPG----- 182

  Fly   196 PKQDRILKNRYPSLCEMCYEPDS--------CD--QTDKHWGRRGALYCLTSGGGNVAWARLDDV 250
                  ......:||.:|....|        |:  .::..:..:|||.||.||.|::|:.     
Zfish   183 ------ATTMAANLCSLCKGQRSYIRQKNFHCETSHSEPFYHNQGALRCLQSGAGDIAFV----- 236

  Fly   251 RSHFGFSGIPAQSNPSDFSYLCPDGHLQPLNASQPCVWVAKPWPVVAARRS---------HAAQV 306
             .|....||. :....:...||.||.|.||::.:.|.....|...|..|.:         .|||:
Zfish   237 -DHTALDGID-EREKDELRLLCTDGSLAPLSSFRTCNLGRGPGGGVVTRMNIRKIARKFLVAAQM 299

  Fly   307 QRLVTGLNHDEPDSWQNA------LL--SLLETYHVFTVPLD--NVIAIDDYLDQATAFQSAYSF 361
            .....|........:::|      ||  .:.|...|....:|  .|:.: ||:    |.......
Zfish   300 SFGWRGRERRRFQLFESASFGGSDLLFRDVTEKLSVLMEDMDMSQVLGL-DYV----ALLKGLGH 359

  Fly   362 PECNPPRSIV-FCTTSIIQHIKC-SWLQEASQVYGVQPN-IQCVRTMDEQQCLDNTKFKETDVVL 423
            ...:...|:| :|..|..:..|| .|      ...::.: :.||:......|::..|..|.|.|.
Zfish   360 EGSSLEDSVVRWCCISHAEQKKCEQW------AISIKSDPLVCVKASSMSDCIEKIKRDEVDAVS 418

  Fly   424 VDQEMRVKAQRDYNLVPLLYEFAADMHDR---------------YVTIALVHKDAKFESFRDLKG 473
            :|......|.: ..|||::.|:..:..:.               ...:|:|.:.:|...|..|..
Zfish   419 LDATHAFIAGK-CGLVPVVTEYYGEKCETSAGAGGHFESNELPPVYGVAVVRRSSKSLFFGSLAD 482

  Fly   474 ARACLPSFEGAAH--LSVQETIV-----NATGKVQSLHSYFHRDSCLWNLQSGRKCPL------- 524
            .|:|.......|.  |.|:.|:.     :|..:...::|......||...| |..|.:       
Zfish   483 RRSCHSHMYSPAGWVLPVRHTLSTEHNNSAPCEPNKVYSEVFWKGCLPGGQ-GNLCKVCMGGTEE 546

  Fly   525 ------------HYQGDEGALRCL------SEGADVAFLSSDVYKKYVVGNLTSNWLTPGNHKDF 571
                        .|.|:.||||||      ....||||:.....:..:....||.|.......||
Zfish   547 AATKRCADNHNERYYGNMGALRCLVGDPTGKSFGDVAFMEHHNLESNIERLNTSGWAEGWVTWDF 611

  Fly   572 RVLCPYGGIEKRSNFEYCYLHWTTRGHLMTHNSSLTRRNEIYNSLRDMDQLFGRKYKSETRPFTL 636
            .:||..|.....|.::.|.|.......:|| ...||.|  ||      |.|...:..:|.||.:.
Zfish   612 ELLCSDGSRAPLSQWKSCNLGAVPPNIVMT-RPVLTAR--IY------DLLMKSQDTTEARPHSG 667

  Fly   637 YGIFDKR----NNVLFRDDTDGLL 656
            :.:|:.:    :::||:|.|..|:
Zfish   668 FHLFESQQYGESDLLFKDVTKCLV 691

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsf3NP_523759.1 PBP2_transferrin 33..368 CDD:270247 84/395 (21%)
PBP2_transferrin 369..681 CDD:270247 79/343 (23%)
TR_FER 370..656 CDD:214514 78/340 (23%)
zgc:172271NP_001107938.1 PBP2_transferrin 25..357 CDD:270247 80/372 (22%)
TR_FER 26..357 CDD:214514 80/371 (22%)
TR_FER 369..713 CDD:214514 78/341 (23%)
PBP2_transferrin 369..713 CDD:270247 78/341 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11485
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.