DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mrj and CG5001

Sequence 1:NP_001246364.1 Gene:mrj FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster

Alignment Length:386 Identity:102/387 (26%)
Similarity:146/387 (38%) Gaps:130/387 (34%)


  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDA 67
            ||||||.:.::|||.|:|||||||||::|||||  ....|..:|:|::||||||||..||.:|| 
  Fly     4 DYYKILGLPKTATDDEIKKAYRKLALRYHPDKN--KAANAEDKFKEVAEAYEVLSDKSKREVYD- 65

  Fly    68 RATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSGNRYQAFTF 132
                 |....|..|..:      ||||...:|     :.|.::       |..|.        ||
  Fly    66 -----KYGEDGLKSGGT------RNGGPSSNS-----FTYQFH-------GDPRA--------TF 99

  Fly   133 RNIF-EGTPFHKMFEKKRRIYDEYGKD-------------GLGDRGQSRSHARHHYSTHDFDDFD 183
            ...| ...||...|:....::|:...|             |:|        :||           
  Fly   100 AQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDFFSSPFGGIG--------SRH----------- 145

  Fly   184 ILGGFQFAFRPPEEVFREF-FGIHSPFA-----------DLFRDANGHSNGSTSGSSGSRRNGGS 236
               |....|||.   ||.. |.:|:||.           ||:.......:|.......|||...:
  Fly   146 ---GLGSGFRPS---FRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKISRRIVQA 204

  Fly   237 SGSSRHHHHHHQHKVASPFGAPMLNYSMMDFFMPTS---GFTSFSSMT---HGNGSSG------V 289
            .||||..                      :.|:..|   |:.|.:.:|   .|:.:.|      |
  Fly   205 DGSSRKE----------------------EKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIV 247

  Fly   290 THISSGPGASVKRTSTSTVFVNGKKLMTKRVV---------ENGKETVFSYENDVLKSKTV 341
            ..|...|.|..||..:...:.  .:|..|:.:         .:|.:...|...:::|..||
  Fly   248 FIIRDKPHAMFKREGSDLRYT--ARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTV 306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 38/63 (60%)
DnaJ 3..66 CDD:278647 38/63 (60%)
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 102/387 (26%)
DnaJ 4..65 CDD:278647 38/63 (60%)
DnaJ_C 174..338 CDD:199909 30/158 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116900584
eggNOG 1 0.900 E1_COG0484
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.