DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44243 and AT3G29010

DIOPT Version :9

Sequence 1:NP_001188958.1 Gene:CG44243 / 36795 FlyBaseID:FBgn0265178 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001327163.1 Gene:AT3G29010 / 822541 AraportID:AT3G29010 Length:262 Species:Arabidopsis thaliana


Alignment Length:210 Identity:44/210 - (20%)
Similarity:79/210 - (37%) Gaps:43/210 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 NDPCVVIGRHQNPFTEANVSQLVERGITLARRNSGGGAVYHDLGNLNCTFFSPRERYDRKYNLNI 159
            |.|.:|:|....|.....|..::|..|.:.:|.:|||.|..|...|   |.|.....|...|:..
plant    50 NVPTIVMGMSGKPSQLLEVGPVMEDRIPVIKRFTGGGTVIVDKSTL---FVSLICNKDDVPNVQP 111

  Fly   160 VTRALFREWA------IKAEIN----ERDDIVVMNKKISGTAAKLGHPNSYHHCTILASANKLHL 214
            ..|::. .|:      :...:|    ..:|.|..::|..|.|..:......||.:.|...:..::
plant   112 YPRSVM-AWSGSLYDEVFKSVNGFQLRENDYVFGDRKFGGNAQSIIKNRWIHHTSFLWDYDVRNM 175

  Fly   215 G------------------ESLVR-----EPANYISKATASVPSPIRNLVDVNRTVNVAQLRSAV 256
            .                  :.:.|     |.::::.|...:|    ||...: :.||:..:.|..
plant   176 AYLKLPSRVPQYRLERDHTDFVCRMKDYIERSDFVEKTVKAV----RNQFTL-KQVNLEDIDSYA 235

  Fly   257 GYEYLRTA-ATTLED 270
            ...||:|. ..|:|:
plant   236 KGGYLKTTRLLTMEE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44243NP_001188958.1 LplA 63..311 CDD:223173 44/210 (21%)
lipoyltrans 60..380 CDD:161920 44/210 (21%)
AT3G29010NP_001327163.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003725
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.