DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8435 and YJU2

DIOPT Version :9

Sequence 1:NP_611092.2 Gene:CG8435 / 36789 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_012828.1 Gene:YJU2 / 853767 SGDID:S000001578 Length:278 Species:Saccharomyces cerevisiae


Alignment Length:275 Identity:94/275 - (34%)
Similarity:144/275 - (52%) Gaps:48/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSERKVLNKYYPPDFDPSKIPRM--KLAK-----NRQY-TVRLMAPFNMRCKTCGEYIYKGKKFN 57
            |||||.:|||||||::|.:..::  |:||     |:.: ::|||.||:|||..|.|||.|.:|||
Yeast     1 MSERKAINKYYPPDYNPLEAEKLSRKMAKKLKTMNKSHASIRLMTPFSMRCLECNEYIPKSRKFN 65

  Fly    58 ARKEDVENETYL-GIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFM------------ 109
            .:|| :..|.|| .|:|||..|.|.||...|:|:|||.|:||.:|.|..||::            
Yeast    66 GKKE-LLKEKYLDSIKIYRLTISCPRCANSIAFRTDPGNSDYVMEVGGVRNYVPQKPNDDLNAKT 129

  Fly   110 ALKLAEEQARR--EEQELRD-------EEANNPMKLLENRTQQSRNEIETIESLEELR----DLN 161
            |::..:|..:|  .|:|:..       |:|::.|.|||.|..:.:.|.|..|.||.||    :::
Yeast   130 AVESIDETLQRLVREKEMEQNEKMGIKEQADDKMDLLEKRLAKIQQEQEDDEELENLRKKNLEMS 194

  Fly   162 RRQQTVDYNTLLQQYNTVETERERQEREEREDEDFIKSVNFKNKPEGSSRVVAEEIIEEIKDEPL 226
            :|.:.::.:...||...|.|:    :.:...|:.|.......|||..::         :.|..||
Yeast   195 QRAEMINRSKHAQQEKAVTTD----DLDNLVDQVFDNHRQRTNKPGNNN---------DEKRTPL 246

  Fly   227 DTPSAPPPAKQAKPS 241
            ..|::.....|.|.|
Yeast   247 FNPTSTKGKIQKKSS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 73/196 (37%)
DUF572 8..>177 CDD:282371 75/202 (37%)
YJU2NP_012828.1 COG5134 7..278 CDD:227463 89/269 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344330
Domainoid 1 1.000 119 1.000 Domainoid score I1276
eggNOG 1 0.900 - - E1_COG5134
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I1232
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002595
OrthoInspector 1 1.000 - - oto100302
orthoMCL 1 0.900 - - OOG6_102870
Panther 1 1.100 - - LDO PTHR12111
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2441
SonicParanoid 1 1.000 - - X1951
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.