DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8435 and AT1G25988

Sequence 1:NP_611092.2 Gene:CG8435 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_173933.1 Gene:AT1G25988 AraportID:AT1G25988 Length:180 Species:Arabidopsis thaliana

Alignment Length:160 Identity:37/161 (23%)
Similarity:67/161 (42%) Gaps:37/161 (23%)


  Fly    90 KTDPQNTDYEIEAGATRNF----------MAL-------KLAEEQARREEQE--LRDEEANNPMK 135
            ||||||.:|.|.:||.:..          |.|       |||:...|.|.||  |:.::|..|..
plant    27 KTDPQNCEYVITSGAQKKVEEYEAEDAETMELTAEQEKGKLADPFYRLEHQEVDLQKKKAAEPFL 91

  Fly   136 LLENRTQQSRNEIETIESLEELRDLNRRQQTVDYNTLLQQYN------------TVETERERQER 188
            :...|...:|:...|.::....|...:..:..:.:...::..            .:|.|:....|
plant    92 VRLQRVSDARHADGTQKTCSRRRGCFKEARLGEKSDFFERVKKILRLPQTLLGVIIEQEKNGAGR 156

  Fly   189 EEREDEDFIKSVNFKNKPEGSSRVVAEEII 218
            :|:|:.   :|::.|: .||  |:.:..|:
plant   157 KEKENN---RSISIKS-TEG--RIQSFSIV 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 26/99 (26%)
DUF572 8..>177 CDD:282371 26/106 (25%)
AT1G25988NP_173933.1 DUF572 <27..>104 CDD:282371 24/77 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1583452at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.