DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8435 and AT1G25682

Sequence 1:NP_611092.2 Gene:CG8435 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001322477.1 Gene:AT1G25682 AraportID:AT1G25682 Length:310 Species:Arabidopsis thaliana

Alignment Length:339 Identity:83/340 (24%)
Similarity:136/340 (40%) Gaps:76/340 (22%)


  Fly     1 MSERKVLNKYYPPDFDPSK------------IPRMKLAKNRQYTVRLMAPFNMRCKTCGEYIYKG 53
            :|..:..|.||||::.|.:            ..|.|........:|...|:|:.|..|...|.||
plant     4 LSAARADNFYYPPEWTPDQGSLNKFQGQHPLRERAKKIGEGILVIRFEMPYNIWCGGCSSMIAKG 68

  Fly    54 KKFNARKEDVENETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMALKLAEEQA 118
            .:|||.|:.|.|  |...:|:.|.:|...|..||..:|||||.:|.|.:||.:     |:.|.:|
plant    69 VRFNAEKKQVGN--YYSTKIWSFAMKSPCCKHEIVIQTDPQNCEYVITSGAQK-----KVEEYEA 126

  Fly   119 R-REEQELRDEEAN----NPMKLLENRTQQSRNEIETIESLEELRDLNRRQQTVDYNTLLQQYNT 178
            . .|..||..|:..    :|...||::....:.:......|..|:.::..:...||:  |.:...
plant   127 EDAETMELTAEQEKGKLADPFYRLEHQEVDLQKKKAAEPLLVRLQRVSDARHADDYS--LNKALR 189

  Fly   179 VETERERQEREERE---------------DEDFIK---SVNFKNKPEGSSRVVAEEIIEEIKDEP 225
            .:..|.|:...|.|               .|:.||   :|.||:|.:           :..||  
plant   190 AQLRRHRKRVAEEETASRKLGLGIRLLPKSEEDIKAASNVKFKSKFD-----------KNRKD-- 241

  Fly   226 LDTPSAPPPAKQAKPSTISLSATSSSKASAAQSMVKRKTPLVLVKPKATAVAKPTVATG---TTQ 287
                      |:|.....|:...||..:|      |::..|...:.|.:|.:..::..|   .:.
plant   242 ----------KRALIHASSIFPESSYSSS------KKRMELEAKRRKISAASASSLLRGGFKASS 290

  Fly   288 VESKPAATTPSVVS 301
            :.:.|:|:.|.|.|
plant   291 LSTNPSASKPKVSS 304

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 52/180 (29%)
DUF572 8..>177 CDD:282371 53/186 (28%)
AT1G25682NP_001322477.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1583452at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.