DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8435 and AT1G25682

DIOPT Version :9

Sequence 1:NP_611092.2 Gene:CG8435 / 36789 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001322477.1 Gene:AT1G25682 / 839146 AraportID:AT1G25682 Length:310 Species:Arabidopsis thaliana


Alignment Length:339 Identity:83/339 - (24%)
Similarity:136/339 - (40%) Gaps:76/339 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSERKVLNKYYPPDFDPSK------------IPRMKLAKNRQYTVRLMAPFNMRCKTCGEYIYKG 53
            :|..:..|.||||::.|.:            ..|.|........:|...|:|:.|..|...|.||
plant     4 LSAARADNFYYPPEWTPDQGSLNKFQGQHPLRERAKKIGEGILVIRFEMPYNIWCGGCSSMIAKG 68

  Fly    54 KKFNARKEDVENETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMALKLAEEQA 118
            .:|||.|:.|.|  |...:|:.|.:|...|..||..:|||||.:|.|.:||.:     |:.|.:|
plant    69 VRFNAEKKQVGN--YYSTKIWSFAMKSPCCKHEIVIQTDPQNCEYVITSGAQK-----KVEEYEA 126

  Fly   119 R-REEQELRDEEAN----NPMKLLENRTQQSRNEIETIESLEELRDLNRRQQTVDYNTLLQQYNT 178
            . .|..||..|:..    :|...||::....:.:......|..|:.::..:...||:  |.:...
plant   127 EDAETMELTAEQEKGKLADPFYRLEHQEVDLQKKKAAEPLLVRLQRVSDARHADDYS--LNKALR 189

  Fly   179 VETERERQEREERE---------------DEDFIK---SVNFKNKPEGSSRVVAEEIIEEIKDEP 225
            .:..|.|:...|.|               .|:.||   :|.||:|.:           :..||  
plant   190 AQLRRHRKRVAEEETASRKLGLGIRLLPKSEEDIKAASNVKFKSKFD-----------KNRKD-- 241

  Fly   226 LDTPSAPPPAKQAKPSTISLSATSSSKASAAQSMVKRKTPLVLVKPKATAVAKPTVATG---TTQ 287
                      |:|.....|:...||..:|      |::..|...:.|.:|.:..::..|   .:.
plant   242 ----------KRALIHASSIFPESSYSSS------KKRMELEAKRRKISAASASSLLRGGFKASS 290

  Fly   288 VESKPAATTPSVVS 301
            :.:.|:|:.|.|.|
plant   291 LSTNPSASKPKVSS 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 51/179 (28%)
DUF572 8..>177 CDD:282371 53/185 (29%)
AT1G25682NP_001322477.1 DUF572 13..307 CDD:398281 81/330 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5134
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1583452at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.