DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8435 and AT1G17130

Sequence 1:NP_611092.2 Gene:CG8435 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001077550.1 Gene:AT1G17130 AraportID:AT1G17130 Length:338 Species:Arabidopsis thaliana

Alignment Length:347 Identity:140/348 (40%)
Similarity:200/348 (57%) Gaps:25/348 (7%)


  Fly     1 MSERKVLNKYYPPDFDPSKIPRMKLAKNRQYTVRLMAPFNMRCKTCGEYIYKGKKFNARKEDV-- 63
            |.|||||||||||||||:|:.|::..||:|..||:|.|.::||.|||.|||||.|||:|||||  
plant     1 MGERKVLNKYYPPDFDPAKLQRLRRPKNQQIKVRMMLPMSVRCGTCGNYIYKGTKFNSRKEDVIG 65

  Fly    64 EN-----ETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMALKLAEEQARREEQ 123
            ||     :|||||:|:|||.|||:|..|::.||||||:||.:|:||:||:...:..:|:..:::|
plant    66 ENFSFDVQTYLGIQIFRFYFKCTKCSAELTMKTDPQNSDYIVESGASRNYEPWRAEDEEVDKDKQ 130

  Fly   124 ELRDEEANNPMKLLENRTQQSRNEIETIESLEELRDLNRRQQTVDYNTLLQQYNTVETERERQER 188
            :...||..:.||.|||||..|:.|::.|.:|:|::.:..|..||..:.:|:...  .|..|:.:|
plant   131 KRDAEEMGDAMKSLENRTLDSKREMDIIAALDEMKSMKSRHATVSVDAMLEALQ--RTGAEKVKR 193

  Fly   189 EEREDEDFIKSVNFKNKPEGSSRVVAEEIIEEIKDEPLDTPSAPPPAKQAKPSTISLSATSSSKA 253
            .|.|||..|||: |..:.|...|:..|||.::..|:.:|  ..|...|:.|.|:..|    |.|.
plant   194 IEEEDEAVIKSI-FGKQKEVIRRIADEEIDDDYDDDDID--DYPSLQKEKKGSSSDL----SKKR 251

  Fly   254 SAAQSMVKRKTPLVL-------VKPKATAVAKPTVATGTTQVESKPAATTPSVVSAPAETKATNQ 311
            .|.:......|.::.       .:||..|::|....:...:|..|....|.|...|||:.:....
plant   252 KATEVSPSNPTDILTSSSAENPKEPKKQAISKQPFKSVHIKVIKKQPQPTSSSTPAPAKPEEKKS 316

  Fly   312 PAAAPAGL-SLLAAY-SDSSED 331
            ..||...| ||...| ||..||
plant   317 DGAANTSLASLFQNYGSDEDED 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 86/170 (51%)
DUF572 8..>177 CDD:282371 86/176 (49%)
AT1G17130NP_001077550.1 COG5134 7..>195 CDD:227463 90/190 (47%)
DUF572 8..216 CDD:282371 99/211 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 232 1.000 Inparanoid score I1100
OMA 1 1.010
OrthoDB 1 1.010 D1583452at2759
OrthoInspector 1 1.000 T124647
orthoMCL 1 0.900 OOG5_128644
Panther 1 1.100 LDO PTHR12111
Phylome 1 0.910 0.667 Consistency score
87.980

Return to query results.
Submit another query.