DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8435 and AT3G43250

Sequence 1:NP_611092.2 Gene:CG8435 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_189911.1 Gene:AT3G43250 AraportID:AT3G43250 Length:249 Species:Arabidopsis thaliana

Alignment Length:241 Identity:101/242 (42%)
Similarity:148/242 (61%) Gaps:25/242 (10%)


  Fly     1 MSERKVLNKYYPPDFDPSKIPRMKLAKNRQYTVRLMAPFNMRCKTCGEYIYKGKKFNARKEDVEN 65
            |.|||.|||||||||||.||.|:|..||:|..:|.|.|..:||.|||.|:.:|.|||.|:|||..
plant     1 MGERKNLNKYYPPDFDPKKIHRIKKPKNQQKKIRFMLPVRVRCNTCGNYMSEGTKFNCRQEDVIT 65

  Fly    66 ETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMALKLAEEQARREEQELRDEEA 130
            |||||::|:|||||||:||.|::.||||:|..|.:|:||:..:...:..||:.:::.:       
plant    66 ETYLGLKIHRFYIKCTKCLAELTIKTDPKNHSYTVESGASCLYNGHEDIEEEKKKKHE------- 123

  Fly   131 NNPMKLLENRTQQSRNEIETIESLEELRDLNRRQQTVDYNTLLQQYNTVETERERQEREEREDED 195
             |.::.|||||..|:.|||.:.||:||:.:..|:.::..:.:|:..    :.|::||.|..|:|.
plant   124 -NALESLENRTVVSKREIEVMASLDELKSMKSRRASLSVDYMLEDL----SRRKKQEEENVEEEL 183

  Fly   196 FIKSVNFKNKPEGSSRVVAEEIIEEIKD-EPLDTPSAPPPAKQAKP 240
            .|||:.|      ..|:..:|  |:.|: |..|...    .|:.||
plant   184 LIKSIKF------GKRIRTDE--EKKKNYEAFDEKK----KKKKKP 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 77/163 (47%)
DUF572 8..>177 CDD:282371 77/169 (46%)
AT3G43250NP_189911.1 COG5134 7..>208 CDD:227463 93/221 (42%)
DUF572 8..203 CDD:282371 91/215 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1583452at2759
OrthoInspector 1 1.000 T124647
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12111
Phylome 1 0.910 0.667 Consistency score
44.020

Return to query results.
Submit another query.