DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8435 and AT2G32050

DIOPT Version :9

Sequence 1:NP_611092.2 Gene:CG8435 / 36789 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_180765.1 Gene:AT2G32050 / 817765 AraportID:AT2G32050 Length:254 Species:Arabidopsis thaliana


Alignment Length:271 Identity:100/271 - (36%)
Similarity:153/271 - (56%) Gaps:42/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSERKVLNKYYPPDFDPSKIPRMKLAKNRQYTVRLMAPFNMRCKTCGEYIYKGKKFNARKEDVEN 65
            |.|||.|||||||:|||.:|||::..||:|..:|.|.|..:||.|||.|:.:|.|.|.|:|:|..
plant     1 MGERKGLNKYYPPNFDPKQIPRIRKPKNQQRKIRSMVPLRIRCNTCGNYMSEGTKINCREENVIG 65

  Fly    66 ETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMALKLAEEQARREEQELRDEEA 130
            ||||||:|:|||.||::|..|:..||||:|:.|..|:|||       ...:|...|||.   |:.
plant    66 ETYLGIKIHRFYFKCSKCCTELILKTDPKNSSYVAESGAT-------CVYDQHEEEEQA---EDG 120

  Fly   131 NNPMKLLENRTQQSRNEIETIESLEELRDLNRRQQTVDYNTLLQQYNTVETERERQEREEREDED 195
            .:.|..||.||..|:.|::.:.:|:|::.:..|:.:|..:::|:..    ::|.::|.|..::||
plant   121 GDRMSSLEKRTLVSKREVDVMAALDEMKSMKSRRVSVSVDSMLEDL----SKRHKEEEEVAKEED 181

  Fly   196 --FIKSVNFKNKPEGSSRVVAEEIIE-----EIKDEPLDTPSAPPPAKQAKPSTISLSATSSSKA 253
              .|||..|..:    .|:|.||..|     :::.|.:|         :.||.|..|:...:.| 
plant   182 AALIKSTKFGKQ----RRIVDEETDEMEKTKKVRMEAVD---------EKKPKTKKLACIITLK- 232

  Fly   254 SAAQSMVKRKT 264
                   |:||
plant   233 -------KKKT 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 71/162 (44%)
DUF572 8..>177 CDD:282371 71/168 (42%)
AT2G32050NP_180765.1 DUF572 9..>208 CDD:424288 84/216 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5134
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1583452at2759
OrthoFinder 1 1.000 - - FOG0002595
OrthoInspector 1 1.000 - - otm3495
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12111
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1951
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.