DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8435 and Yju2

Sequence 1:NP_611092.2 Gene:CG8435 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_082657.1 Gene:Yju2 MGIID:1920136 Length:314 Species:Mus musculus

Alignment Length:340 Identity:169/341 (50%)
Similarity:219/341 (64%) Gaps:34/341 (10%)


  Fly     1 MSERKVLNKYYPPDFDPSKIPRMKLAKNRQYTVRLMAPFNMRCKTCGEYIYKGKKFNARKEDVEN 65
            |||||||||||||||||||||::||.|:|||.|||||||||||||||||||||||||||||.|:|
Mouse     1 MSERKVLNKYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKTCGEYIYKGKKFNARKETVQN 65

  Fly    66 ETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMALKLAEEQARREEQELRDEEA 130
            |.|||:.|:||||||||||.||:|||||:||||.:|.||||||.|.||.||:.:|.::|..|||.
Mouse    66 EAYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQAEKLLEEEEKRVQKEREDEEL 130

  Fly   131 NNPMKLLENRTQQSRNEIETIESLEELRDLNRRQQTVDYNTLLQQYNTVETERERQEREEREDED 195
            |||||:|||||:.|:.|:|.:|:|:||:|||:||..||:..:|:|:...:.:.::|:.||.|.| 
Mouse   131 NNPMKVLENRTKDSKLEMEVLENLQELKDLNQRQAHVDFEAMLRQHRMSQEQWQQQQEEEDERE- 194

  Fly   196 FIKSVNFKNKPEGSSRVVAEE-----IIEEIKDEPLDTPSAPPPAKQAKPSTISLSATSSSKASA 255
                          :..:.||     ::|:.:.|....||.|..|.:..|:.| |:....:|.. 
Mouse   195 --------------TAALLEEARHRRLLEDSESEDEAPPSRPRAAARPNPTAI-LNEVPQTKRK- 243

  Fly   256 AQSMVKRKTPLVLVKPKATAVAKPTVATGTTQVESKPAATTPSVVSAPAETKATNQPAAAP--AG 318
            |:::..:.....||.||..    .|.|.|.::     ....|:...||...||.|.....|  :.
Mouse   244 AEALCSKAQLAGLVVPKKV----KTEANGASE-----QVGVPTAAGAPKSRKADNPTPQTPGTSS 299

  Fly   319 LSLLAAYSDSSEDSN 333
            ||.|.||.| ||||:
Mouse   300 LSQLGAYGD-SEDSD 313

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 119/163 (73%)
DUF572 8..>177 CDD:282371 120/169 (71%)
Yju2NP_082657.1 COG5134 7..>156 CDD:227463 110/149 (74%)
DUF572 8..261 CDD:282371 142/270 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C225873144
eggNOG 1 0.900 E1_COG5134
Hieranoid 1 1.000
Homologene 1 1.000 H6350
Inparanoid 1 1.050 302 1.000 Inparanoid score I2645
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1583452at2759
OrthoFinder 1 1.000 FOG0004440
OrthoInspector 1 1.000 T1083017
orthoMCL 1 0.900 OOG5_128644
Panther 1 1.100 LDO PTHR12111
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2441
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.