DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8435 and YJU2

DIOPT Version :9

Sequence 1:NP_611092.2 Gene:CG8435 / 36789 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_060544.2 Gene:YJU2 / 55702 HGNCID:25518 Length:323 Species:Homo sapiens


Alignment Length:347 Identity:177/347 - (51%)
Similarity:220/347 - (63%) Gaps:41/347 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSERKVLNKYYPPDFDPSKIPRMKLAKNRQYTVRLMAPFNMRCKTCGEYIYKGKKFNARKEDVEN 65
            |||||||||||||||||||||::||.|:|||.|||||||||||||||||||||||||||||.|:|
Human     1 MSERKVLNKYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKTCGEYIYKGKKFNARKETVQN 65

  Fly    66 ETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMALKLAEEQARREEQELRDEEA 130
            |.|||:.|:||||||||||.||:|||||:||||.:|.||||||.|.||.||:.:|.::|..|||.
Human    66 EVYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQAEKLLEEEEKRVQKEREDEEL 130

  Fly   131 NNPMKLLENRTQQSRNEIETIESLEELRDLNRRQQTVDYNTLLQQYNTVETERERQEREEREDED 195
            |||||:|||||:.|:.|:|.:|:|:||:|||:||..||:..:|:|:...|.||.||::||.|.| 
Human   131 NNPMKVLENRTKDSKLEMEVLENLQELKDLNQRQAHVDFEAMLRQHRLSEEERRRQQQEEDEQE- 194

  Fly   196 FIKSVNFKNKPEGSSRVVAEE-----IIEEIKDEPLDTPSAPPPAKQAKPSTISLSATSSSK--- 252
                          :..:.||     ::|:...|....||...||.:..|:.|...|....:   
Human   195 --------------TAALLEEARKRRLLEDSDSEDEAAPSPLQPALRPNPTAILDEAPKPKRKVE 245

  Fly   253 --ASAAQSMVKRK--TPLVLVKPKATAVAKPTVATGTTQVESKPAATTPSVVSAPAETKATNQPA 313
              ..:..|:..|.  :.||:||   .|.|.|..:.|..|     ||.||   .||...|..|...
Human   246 VWEQSVGSLGSRPPLSRLVVVK---KAKADPDCSNGQPQ-----AAPTP---GAPQNRKEANPTP 299

  Fly   314 AAP--AGLSLLAAYSDSSEDSN 333
            ..|  :.||.|.||.| |:|||
Human   300 LTPGASSLSQLGAYLD-SDDSN 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 119/162 (73%)
DUF572 8..>177 CDD:282371 120/168 (71%)
YJU2NP_060544.2 DUF572 9..318 CDD:398281 166/335 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..323 39/126 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149358
Domainoid 1 1.000 289 1.000 Domainoid score I1576
eggNOG 1 0.900 - - E1_COG5134
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6350
Inparanoid 1 1.050 304 1.000 Inparanoid score I2656
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1583452at2759
OrthoFinder 1 1.000 - - FOG0002595
OrthoInspector 1 1.000 - - oto91622
orthoMCL 1 0.900 - - OOG6_102870
Panther 1 1.100 - - LDO PTHR12111
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2441
SonicParanoid 1 1.000 - - X1951
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.