DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8435 and YJU2

Sequence 1:NP_611092.2 Gene:CG8435 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_060544.2 Gene:YJU2 HGNCID:25518 Length:323 Species:Homo sapiens

Alignment Length:347 Identity:177/348 (51%)
Similarity:220/348 (63%) Gaps:41/348 (12%)


  Fly     1 MSERKVLNKYYPPDFDPSKIPRMKLAKNRQYTVRLMAPFNMRCKTCGEYIYKGKKFNARKEDVEN 65
            |||||||||||||||||||||::||.|:|||.|||||||||||||||||||||||||||||.|:|
Human     1 MSERKVLNKYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKTCGEYIYKGKKFNARKETVQN 65

  Fly    66 ETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMALKLAEEQARREEQELRDEEA 130
            |.|||:.|:||||||||||.||:|||||:||||.:|.||||||.|.||.||:.:|.::|..|||.
Human    66 EVYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQAEKLLEEEEKRVQKEREDEEL 130

  Fly   131 NNPMKLLENRTQQSRNEIETIESLEELRDLNRRQQTVDYNTLLQQYNTVETERERQEREEREDED 195
            |||||:|||||:.|:.|:|.:|:|:||:|||:||..||:..:|:|:...|.||.||::||.|.| 
Human   131 NNPMKVLENRTKDSKLEMEVLENLQELKDLNQRQAHVDFEAMLRQHRLSEEERRRQQQEEDEQE- 194

  Fly   196 FIKSVNFKNKPEGSSRVVAEE-----IIEEIKDEPLDTPSAPPPAKQAKPSTISLSATSSSK--- 252
                          :..:.||     ::|:...|....||...||.:..|:.|...|....:   
Human   195 --------------TAALLEEARKRRLLEDSDSEDEAAPSPLQPALRPNPTAILDEAPKPKRKVE 245

  Fly   253 --ASAAQSMVKRK--TPLVLVKPKATAVAKPTVATGTTQVESKPAATTPSVVSAPAETKATNQPA 313
              ..:..|:..|.  :.||:||   .|.|.|..:.|..|     ||.||   .||...|..|...
Human   246 VWEQSVGSLGSRPPLSRLVVVK---KAKADPDCSNGQPQ-----AAPTP---GAPQNRKEANPTP 299

  Fly   314 AAP--AGLSLLAAYSDSSEDSN 333
            ..|  :.||.|.||.| |:|||
Human   300 LTPGASSLSQLGAYLD-SDDSN 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 119/163 (73%)
DUF572 8..>177 CDD:282371 120/169 (71%)
YJU2NP_060544.2 DUF572 8..274 CDD:309584 149/284 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C225873715
eggNOG 1 0.900 E1_COG5134
Hieranoid 1 1.000
Homologene 1 1.000 H6350
Inparanoid 1 1.050 305 1.000 Inparanoid score I2607
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1583452at2759
OrthoFinder 1 1.000 FOG0004440
OrthoInspector 1 1.000 T1072945
orthoMCL 1 0.900 OOG5_128644
Panther 1 1.100 LDO PTHR12111
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2441
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.