DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8435 and yju2

Sequence 1:NP_611092.2 Gene:CG8435 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001017176.1 Gene:yju2 XenbaseID:XB-GENE-5938025 Length:345 Species:Xenopus tropicalis

Alignment Length:355 Identity:165/356 (46%)
Similarity:220/356 (62%) Gaps:37/356 (10%)


  Fly     1 MSERKVLNKYYPPDFDPSKIPRMKLAKNRQYTVRLMAPFNMRCKTCGEYIYKGKKFNARKEDVEN 65
            |||||||||||||||||||||::||.|:|||.|||||||||||||||||||||||||||||.|:|
 Frog     1 MSERKVLNKYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKTCGEYIYKGKKFNARKETVQN 65

  Fly    66 ETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMALKLAEEQARREEQELRDEEA 130
            |.|||:.|:||||||||||.||:|||||:||||.:|.||||||.|.||.||:.:|.::|..:||.
 Frog    66 ELYLGLPIFRFYIKCTRCLAEITFKTDPENTDYAMEHGATRNFQAEKLIEEEEKRFQKEREEEEL 130

  Fly   131 NNPMKLLENRTQQSRNEIETIESLEELRDLNRRQQTVDYNTLLQQYNTVETERERQEREEREDED 195
            |||||:|||||:.|:.|:|.:|:|:||::||:||..||:..:|:.|.  |||.|.:.|:|.|||.
 Frog   131 NNPMKVLENRTKDSKMEMEVLENLQELKELNQRQANVDFEAMLEVYK--ETEEEIRRRQEEEDEQ 193

  Fly   196 FIKS-----------VNFKNKPEGSS-------RVVAEEIIEEIKDEPLDTPSAPPPAKQAKPST 242
            .:::           |:..:..|||.       :..|.:|:  :|::.:..       |:.:...
 Frog   194 EMRAMMEEANRKRMLVDSDSDEEGSEVKHKHTIKAKATDIL--VKNDHVQN-------KKQRGEK 249

  Fly   243 ISLSATSSSKASAAQSMVKRKTPLV---LVKPKATAVAKPTVATGTTQVESKPAATTPSVVSAP- 303
            :...:...:.......:|.||..:.   ..|...|......:|...|:.::...| .||..:.| 
 Frog   250 LEGGSLKVNSRQLLSGLVTRKQEVAQPDKSKQDNTKTDDEKIALKVTETQNYKLA-LPSKGTIPE 313

  Fly   304 AETKATNQPAAAPAGLS---LLAAYSDSSE 330
            :.||.........:|||   .|.|||||.|
 Frog   314 SHTKNVTSNLPGSSGLSSLMQLGAYSDSEE 343

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 117/163 (72%)
DUF572 8..>177 CDD:282371 118/169 (70%)
yju2NP_001017176.1 COG5134 7..>171 CDD:227463 117/164 (71%)
DUF572 8..>177 CDD:282371 118/169 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C225874616
eggNOG 1 0.900 E1_COG5134
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H6350
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1583452at2759
OrthoFinder 1 1.000 FOG0004440
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.710

Return to query results.
Submit another query.