DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8435 and Yju2

Sequence 1:NP_611092.2 Gene:CG8435 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001103143.1 Gene:Yju2 RGDID:1589601 Length:313 Species:Rattus norvegicus

Alignment Length:344 Identity:163/345 (47%)
Similarity:216/345 (63%) Gaps:43/345 (12%)


  Fly     1 MSERKVLNKYYPPDFDPSKIPRMKLAKNRQYTVRLMAPFNMRCKTCGEYIYKGKKFNARKEDVEN 65
            |||||||||||||||||||||::||.|:|||.|||||||||||||||||||||||||||||.|:|
  Rat     1 MSERKVLNKYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKTCGEYIYKGKKFNARKETVQN 65

  Fly    66 ETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMALKLAEEQARREEQELRDEEA 130
            |.|||:.|:||||||||||.||:|||||:||||.:|.||||||.|.||.||:.:|.::|..|||.
  Rat    66 EAYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQAEKLLEEEEKRMQKEREDEEL 130

  Fly   131 NNPMKLLENRTQQSRNEIETIESLEELRDLNRRQQTVDYNTLLQQY--NTVETERERQEREERED 193
            |||||:|||||:.|:.|:|.:|:|:||:|||:||..||:..:|.|:  :..:.:::::|.:|||.
  Rat   131 NNPMKVLENRTKDSKLEMEVLENLQELKDLNQRQAHVDFEAMLLQHRLSQEQWQQQQEEEDERET 195

  Fly   194 EDFIKSVNFKNKPEGSSRVVAEEIIEEIKDEPLDTPSAPPPAKQAKPSTISLSATSSSKASAAQS 258
            ...::...::            .::::...|....||.|..|.:..|:.| |.....:|.. |:.
  Rat   196 VALLEEARYR------------RLLDDSDSEDEAPPSQPQAAARPNPTAI-LDEVPKTKRK-AEG 246

  Fly   259 MVKRKTPLVLVKPK---------ATAVAKPTVATGTTQVESKPAATTPSVVSAPAETKATNQPAA 314
            :.::.....||.||         :..|..||.....::..:.||..||...|             
  Rat   247 LCRKAQLAGLVIPKKAKTEANRVSEQVRVPTTGAPESRKVANPAPQTPGASS------------- 298

  Fly   315 APAGLSLLAAYSDSSEDSN 333
                ||.|.||.| ||||:
  Rat   299 ----LSQLGAYGD-SEDSD 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 119/163 (73%)
DUF572 8..>177 CDD:282371 120/171 (70%)
Yju2NP_001103143.1 COG5134 7..>178 CDD:227463 121/171 (71%)
DUF572 8..262 CDD:282371 138/268 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C225872975
eggNOG 1 0.900 E1_COG5134
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H6350
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1583452at2759
OrthoFinder 1 1.000 FOG0004440
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12111
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.