DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8435 and yju2

Sequence 1:NP_611092.2 Gene:CG8435 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001104303.1 Gene:yju2 ZFINID:ZDB-GENE-040426-841 Length:345 Species:Danio rerio

Alignment Length:360 Identity:173/361 (48%)
Similarity:228/361 (63%) Gaps:43/361 (12%)


  Fly     1 MSERKVLNKYYPPDFDPSKIPRMKLAKNRQYTVRLMAPFNMRCKTCGEYIYKGKKFNARKEDVEN 65
            |||||||||||||||||||||::||.|:|||.|||||||||||||||||||||||||||||.|:|
Zfish     1 MSERKVLNKYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKTCGEYIYKGKKFNARKETVQN 65

  Fly    66 ETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMALKLAEEQARREEQELRDEEA 130
            |.|||:.|:||||||||||.||:|||||:||||.:|.||||||.|.||.||:.::.:||..|||.
Zfish    66 ELYLGLPIFRFYIKCTRCLAEITFKTDPENTDYAMEHGATRNFQAEKLIEEEEKKIQQEREDEEL 130

  Fly   131 NNPMKLLENRTQQSRNEIETIESLEELRDLNRRQQTVDYNTLLQQYNTVETERERQEREEREDE- 194
            |||||:|||||:.|:.|:|.:|:|:||::||:||..||:..:|.||..:|..::::|:||.|.| 
Zfish   131 NNPMKVLENRTRDSKLEMEVLENLQELKELNQRQAQVDFEGMLGQYKELEQRQKQREQEEDEQET 195

  Fly   195 -DFIKSVNFKNKPEGSSRVVAEEIIEEIKDEPLDTPSAPPPAKQAKPSTISLSATSSSKASAAQS 258
             :.::....|...:..|...||...|..|....|           ||:.|..:.||:|....:.:
Zfish   196 KEMLERALVKRLRDSDSEEEAENAKERSKKHIAD-----------KPTDILTTDTSTSSQGLSSA 249

  Fly   259 MVKRKT---------------PLVLVKPKATAVAKPT--------VATGTTQVESKPAATTPSVV 300
            :.|:::               .||:.|..|.:.:||:        .|.||.....||.:   |:.
Zfish   250 VAKKQSWDRSVGGLSVKGALGSLVVRKKPADSASKPSHAAPPPAAAAAGTQTGAVKPES---SIT 311

  Fly   301 SAPAETKATNQPAAAPAG--LSLLAAYSDSSEDSN 333
            |:.|.:..  ||.:...|  |.||.|||||.:.|:
Zfish   312 SSSASSNI--QPVSCQNGSSLGLLGAYSDSDDSSS 344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 118/163 (72%)
DUF572 8..>177 CDD:282371 120/169 (71%)
yju2NP_001104303.1 DUF572 8..277 CDD:309584 143/280 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C225873031
eggNOG 1 0.900 E1_COG5134
Hieranoid 1 1.000
Homologene 1 1.000 H6350
Inparanoid 1 1.050 310 1.000 Inparanoid score I2551
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1583452at2759
OrthoFinder 1 1.000 FOG0004440
OrthoInspector 1 1.000 T1052331
orthoMCL 1 0.900 OOG5_128644
Panther 1 1.100 LDO PTHR12111
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2441
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.