DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8435 and cwf16

Sequence 1:NP_611092.2 Gene:CG8435 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001342912.1 Gene:cwf16 PomBaseID:SPAC9.13c Length:270 Species:Schizosaccharomyces pombe

Alignment Length:262 Identity:110/263 (42%)
Similarity:150/263 (57%) Gaps:25/263 (10%)


  Fly     1 MSERKVLNKYYPPDFDPSKIPRMKLAK-----NRQYTVRLMAPFNMRCKTCGEYIYKGKKFNARK 60
            ||||||||||.|||:|||..|..|..|     ..:.|||||.||:|||.||||||||||||||||
pombe     1 MSERKVLNKYIPPDYDPSIRPPKKKKKFQGPNGGKLTVRLMTPFSMRCHTCGEYIYKGKKFNARK 65

  Fly    61 EDVENETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMAL--KLAEEQARREEQ 123
            |.. .|.|..|.|.||||:||||..||:|.|||::.||..|:||:||:...  |..:|....|..
pombe    66 EKT-GEKYFSIDILRFYIRCTRCAAEITFITDPKHADYAAESGASRNYEPWHEKRLQEYEENELA 129

  Fly   124 ELRDEEANNPMKLLENRTQQSRNEIETIESLEELRDLNRRQQTV---DYNTLLQQ--YNTVETER 183
            |..|....:.|:.||.:|..::.:::..::|:|||:.:.|:..|   |...||::  |.::|.|.
pombe   130 ERNDIPEEDEMEKLEQKTLDTKRQMQISDALDELREKSARRSRVNIDDAIALLKEDAYGSIEEEE 194

  Fly   184 ERQER-EEREDEDFIKSVNFKNKPEGSSRVVAEEIIEEIKDEPLD----------TPSAPPPAKQ 237
            .::.: ||.|.:...||:......|...|:.||..:|:...:|:|          .|:..|| |.
pombe   195 SKKRKFEEEEIDREAKSLFSSQDGEIIRRLNAETTVEKELPKPIDLVSEKLATSNIPNFQPP-KY 258

  Fly   238 AK 239
            ||
pombe   259 AK 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 81/173 (47%)
DUF572 8..>177 CDD:282371 83/181 (46%)
cwf16NP_001342912.1 DUF572 8..250 CDD:309584 97/243 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 174 1.000 Inparanoid score I1151
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004440
OrthoInspector 1 1.000 T1124670
orthoMCL 1 0.900 OOG5_128644
Panther 1 1.100 LDO PTHR12111
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2441
TreeFam 1 0.960
98.950

Return to query results.
Submit another query.