DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8435 and Ccdc130

Sequence 1:NP_611092.2 Gene:CG8435 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001032733.1 Gene:Ccdc130 RGDID:1307598 Length:385 Species:Rattus norvegicus

Alignment Length:403 Identity:110/404 (27%)
Similarity:165/404 (41%) Gaps:90/404 (22%)


  Fly     1 MSERKVLNKYYPPDFDPSKIPRMKLAKNRQYT-----------------VRLMAPFNMRCKTCGE 48
            |.|||..||||||||:|.|...:    ||.:.                 :|...|:|:.|..|..
  Rat     1 MGERKGQNKYYPPDFNPEKHGSL----NRYHNSHPLRERARKLSQGILIIRFEMPYNIWCDGCKN 61

  Fly    49 YIYKGKKFNARKEDVENETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMALKL 113
            :|..|.::||.|:.|.|  |....||||.:||..|:..|..:|||.|.||.|.:||:|......:
  Rat    62 HIGMGVRYNAEKKKVGN--YYTTPIYRFRMKCHLCVNYIEMQTDPANCDYVIVSGASRKEERWDM 124

  Fly   114 AE-EQARREEQELRDEEANNPMKLLEN-RTQQS--RNEIETIESLEELRDLNRRQQTVDYNTLLQ 174
            .: ||....|.|.:::...:.|..||: ...:|  :..:.|:..::|.:  |..:.....|::|:
  Rat   125 EDNEQVLTTEHEKKEKLETDAMFRLEHGEADRSTLKKALPTLSHIQEAQ--NAWKDDFALNSMLR 187

  Fly   175 QYNTVETERERQEREER----------------EDED-----FIKSVNFKNKPEGSSRVVAEEII 218
            ::.. |.::..||.||:                |.||     .:..::..:..|...|:...|||
  Rat   188 RHFR-EKKKAMQEEEEKDQALQAKANLAIPLVPESEDDRRLAALLRLHTLDSYEDKQRMKRTEII 251

  Fly   219 EEIKDEPLDTPSAP-PPAKQAKPSTI-------SLSATSSSKASAAQSMVKRKTPLVLVKPKATA 275
            ....     .|||. |....:|.||:       ....|.|:.|.....:|:||:......|:.||
  Rat   252 HRSW-----FPSAQGPSTSSSKASTVLKKLCRGRRPPTGSAGAPGDLGIVRRKSREAPESPQCTA 311

  Fly   276 ----VAKPTVATGTTQVESKPAATTPSVVSAP-----AETKATNQPAAAPAG------------- 318
                ..:|....|||. :||   |......||     .|:|......|.|.|             
  Rat   312 DNSLSEEPRGPPGTTP-DSK---TLQGTAEAPRTSKTLESKRNCSDQALPLGSSQEDLLHPNTPN 372

  Fly   319 LSLLAAYSDSSED 331
            .||:|.||||..:
  Rat   373 ASLVADYSDSESE 385

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 54/184 (29%)
DUF572 8..>177 CDD:282371 56/190 (29%)
Ccdc130NP_001032733.1 DUF572 8..238 CDD:282371 64/239 (27%)
COG5134 8..>224 CDD:227463 64/225 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5134
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1583452at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.