DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8435 and saf4

Sequence 1:NP_611092.2 Gene:CG8435 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_595734.2 Gene:saf4 PomBaseID:SPBC18H10.10c Length:299 Species:Schizosaccharomyces pombe

Alignment Length:284 Identity:67/285 (24%)
Similarity:114/285 (40%) Gaps:61/285 (21%)


  Fly     7 LNKYYPPDFDPSKIPRMKLAKNRQYTVRLMAPFNMRCKTCGEYIYKGKKFNARKEDVENETYLGI 71
            :.||.||:...:|   .|..|.|. .:|...||.:.|..|...|.:|.:|||.|:::  .:|...
pombe     6 MGKYIPPEGPNAK---RKFDKLRN-VIRFEMPFPVWCNNCENIIQQGTRFNAVKKEI--GSYYTT 64

  Fly    72 RIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMALKLAEEQARREEQELRDEEANNPMKL 136
            :|:.|.:||..|...|...|||:||:|.:.:|..|......:.|..|:.|..|....:|   ::.
pombe    65 KIWSFSLKCHLCSNPIDVHTDPKNTEYIVASGGRRKIEPQDINERPAKAENDEKVPSDA---IEA 126

  Fly   137 LENRTQQSRNEIETIESLEELRDLNRR---QQTVDYNTLLQQYNTVETERERQEREEREDEDFIK 198
            ||.:..|.::|......:..:.:.|.|   ...|....|.:|:      |||::.|::::   .|
pombe   127 LETQLTQQKSEKHNSSVINFIYEKNERLWSDPFVSSQRLRKQF------RERKKIEKKQE---AK 182

  Fly   199 SVNFKNKPEGSSRVVAEEIIEEIKDEPLDTPSAPPPAKQAKPSTISL------------------ 245
            .::.||:                  ..||....||.:.....:.:.|                  
pombe   183 DLSLKNR------------------AALDIDILPPSSSDKDKALLLLDNELGKNKFIRKLDYRRT 229

  Fly   246 ----SATSSSKASAAQSMVKRKTP 265
                |.|.|:.|..|::...:|.|
pombe   230 LMPSSRTFSTFAKFAETSFAKKDP 253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 46/166 (28%)
DUF572 8..>177 CDD:282371 48/172 (28%)
saf4NP_595734.2 COG5134 6..265 CDD:227463 67/285 (24%)
DUF572 7..226 CDD:282371 60/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2441
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.