DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8435 and F37C12.1

Sequence 1:NP_611092.2 Gene:CG8435 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_498576.1 Gene:F37C12.1 WormBaseID:WBGene00018149 Length:323 Species:Caenorhabditis elegans

Alignment Length:356 Identity:143/357 (40%)
Similarity:195/357 (55%) Gaps:65/357 (18%)


  Fly     2 SERKVLNKYYPPDFDPSKIPRMKLAKNRQYTVRLMAPFNMRCKTCGEYIYKGKKFNARKEDVENE 66
            :||||..||||||||||||||.|..||||:..|:|.||||:|.||.||||||||||.::|..|.|
 Worm     4 TERKVFQKYYPPDFDPSKIPRAKGQKNRQFVQRVMTPFNMQCNTCHEYIYKGKKFNMKRETAEGE 68

  Fly    67 TYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMALKLAEEQARR-EEQELRDEEA 130
            ||||::::|||.:|..||.||:||||.:|.||:.|.||||.|.|:||.::|.:: :|||.  |:|
 Worm    69 TYLGLKLFRFYFRCPNCLAEITFKTDLENCDYQNEHGATRLFEAVKLYQDQQKQVDEQEA--EDA 131

  Fly   131 NNPMKLLENRTQQSRNEIETIESLEELRDLNRRQQTVDYNTLL----------QQYNTVETERER 185
            .:|||:||.||.|||.|:|.:.:||:|::.:|.::.:|....|          |:...:|.|.:|
 Worm   132 KDPMKMLEKRTMQSRQEMEEMGNLEDLQESSRTKECIDTIGFLSSTDPHIAQAQRIKMMEDEDDR 196

  Fly   186 QERE----------ER---EDEDFIKSVNFKNKPEGSSRVVAEEIIEEIKDEPLDTPSA---PPP 234
            ..||          ||   :|||         ..:|:.        |:.||.|  .|||   |..
 Worm   197 MARELMGITSEGRIERRIKDDED---------NSDGAD--------EDDKDIP--GPSASVVPST 242

  Fly   235 AKQAKPSTISLSATSSSKASAAQSMVKRKTPLVLVKPKATAVAKPTVATGTTQVESKPAATTPSV 299
            :...||:...|....|..:........|...:.|:|.     |||:        |...::|..|.
 Worm   243 SSMLKPAIPKLGMDDSGNSRKRNEQRDRFAGIKLIKK-----AKPS--------EPSTSSTASST 294

  Fly   300 VSAPAETKATNQPAAAPAGLSLLAAYSDSSE 330
            .|||....:    :||.:||||||.|...|:
 Worm   295 SSAPPPLPS----SAASSGLSLLADYGSGSD 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 92/164 (56%)
DUF572 8..>177 CDD:282371 94/180 (52%)
F37C12.1NP_498576.1 DUF572 10..220 CDD:282371 104/221 (47%)
COG5134 11..>148 CDD:227463 85/139 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C225866642
eggNOG 1 0.900 E1_COG5134
Hieranoid 1 1.000
Homologene 1 1.000 H6350
Inparanoid 1 1.050 224 1.000 Inparanoid score I2219
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1583452at2759
OrthoFinder 1 1.000 FOG0004440
OrthoInspector 1 1.000 T476895
orthoMCL 1 0.900 OOG5_128644
Panther 1 1.100 LDO PTHR12111
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2441
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.