DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8435 and ZK1307.9

Sequence 1:NP_611092.2 Gene:CG8435 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_496077.1 Gene:ZK1307.9 WormBaseID:WBGene00014250 Length:369 Species:Caenorhabditis elegans

Alignment Length:408 Identity:98/409 (24%)
Similarity:162/409 (40%) Gaps:114/409 (28%)


  Fly     1 MSERKVLNKYYPPDFD-------------PSKIPRMKLAKNRQYTVRLMAPFNMRCKTCGEYIYK 52
            |.|||..|.||||||:             .:...|.|........:|...|||:.|..|..::..
 Worm     1 MGERKGQNFYYPPDFNYKTHKSLNGYHGTHALRERAKKIDQGILVIRFEMPFNIWCLGCHNHVGM 65

  Fly    53 GKKFNARKEDVENETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMAL------ 111
            |.::||.|:.:  ..|....::.|.:||..|......:|||:|.|||:..|.:|..:..      
 Worm    66 GVRYNAEKKKI--GMYYTTPLHEFRMKCHLCDNYYVIRTDPKNFDYELVEGCSRQELRFDPTDIA 128

  Fly   112 -----------KLAEEQARREEQELRD------EEAN-NPMKLLENRTQ-----------QSRNE 147
                       |||.:...::|.|..|      ||.. :.::.::.|.:           |.|||
 Worm   129 QIGAVDRGFTQKLAADAMFKKEHEAEDKDKAATEEGRVDKLEWIQERMRDDFTANSFLRAQFRNE 193

  Fly   148 IETIESLEELRDLNRRQQ-TVDYNTLLQQYNTVETERER-------QEREEREDEDFIKSVNFKN 204
            .:::.. ...||.|.|.: ::....||.     |||.:|       :.|:.:..:|.::|     
 Worm   194 KKSLNE-TRARDANLRDKLSIGTTQLLP-----ETEEDRRIASMMTRYRDTKTHDDHLES----- 247

  Fly   205 KPEGSSRVVAEEIIEEIKDEPLDTPS--------APPPAKQAKPST--------ISLSATSSSKA 253
               ...|:.:..|..  :.|..||||        |.|.|.:...:|        |:.|.:::..:
 Worm   248 ---SRDRIESRRIFR--RPEETDTPSTSSGSSGGAVPSASERLKATMKAERDKRINASFSTAGTS 307

  Fly   254 SAAQSM--VKRKTPLVLVKPKATAVAKPTVATGTTQVESKPAATTPSVVSAPAETKATNQPAAAP 316
            ||.|.:  :|||:...|    ...:.|......:.| :.:||...|: :|.|             
 Worm   308 SATQKLLGIKRKSASSL----GVQIKKAAPENSSLQ-DEEPAVEKPN-ISNP------------- 353

  Fly   317 AGLSLLA-AYSDSSEDSN 333
              :||:| .|.:||:||:
 Worm   354 --ISLIAQEYGNSSDDSD 369

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 50/212 (24%)
DUF572 8..>177 CDD:282371 52/218 (24%)
ZK1307.9NP_496077.1 DUF572 8..227 CDD:282371 56/227 (25%)
COG5134 8..>210 CDD:227463 50/205 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5134
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1583452at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2441
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.