DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8435 and yju2b

DIOPT Version :9

Sequence 1:NP_611092.2 Gene:CG8435 / 36789 FlyBaseID:FBgn0034084 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001096262.1 Gene:yju2b / 100124826 XenbaseID:XB-GENE-5758023 Length:386 Species:Xenopus tropicalis


Alignment Length:391 Identity:102/391 - (26%)
Similarity:160/391 - (40%) Gaps:64/391 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSERKVLNKYYPPDFDPSKIPRMKLAKNRQ-------------YTVRLMAPFNMRCKTCGEYIYK 52
            |.|||..||||||||||:|...:...:|..             ..:|...|:|:.|..|..:|..
 Frog     1 MGERKGTNKYYPPDFDPAKHGSLNRYRNSHPLRERARKLSQGILIIRFEMPYNIWCDGCKNHIGM 65

  Fly    53 GKKFNARKEDVENETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAGATRNFMALKLAE-E 116
            |.::||.|:.|.|  |....||||.:||..|:..|..:|||.|.||.|.:||.|......:.: |
 Frog    66 GVRYNAEKKKVGN--YYTTPIYRFRMKCHLCVNYIEMQTDPANCDYVIVSGAQRKEERWDMQDNE 128

  Fly   117 QARREEQELRDEEANNPMKLLENRTQQSRNEIETIESLEELRDLNRRQQTVDY--NTLLQQYNTV 179
            |....|.|.:.....:.|..||:..:..........||.||:::....:. |:  |:||:  :..
 Frog   129 QILTTEHEEKQRLETDSMFRLEHGAKDKAKLQRAAPSLSELQEVQSAWKD-DFAINSLLR--SKF 190

  Fly   180 ETERERQEREEREDEDFIK--SVNFKNKPEGS-------------------------SRVVAEEI 217
            ..|:::.:.||..|:..:|  |::.|..||..                         |.:.....
 Frog   191 RDEKKQIKEEEERDQALLKKASLDLKLVPEKEEDKKLAALLKYRSLESYEQKQKKKRSEICNRSW 255

  Fly   218 IEEIKDEPLDTPSAPPPAKQAKPSTISLSATSS------SKASAAQSMVKRKTPLVLVKPKATAV 276
            .....|....||.........:|.|:|....|.      .:.|..::..:.|.|.......:::.
 Frog   256 FSPGADSGQQTPGNALRKLGIRPRTLSAPGISPVTLGVVRRTSKEENRAEDKLPASPNGSCSSSA 320

  Fly   277 AKPTVATGT-TQVESKPAATTPSVVSAPAETKATNQPAAA-------PAGLS-LLAAYSDSSEDS 332
            ...:|...| ::|||:....:.|.:|: .:|.||:...|.       ...|| |:..|||||.:|
 Frog   321 GGESVREETGSKVESRERTQSESDLSS-VQTLATSTSTAQGKTSTAHTVSLSCLVPDYSDSSSES 384

  Fly   333 N 333
            :
 Frog   385 D 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8435NP_611092.2 COG5134 7..>170 CDD:227463 55/178 (31%)
DUF572 8..>177 CDD:282371 58/184 (32%)
yju2bNP_001096262.1 DUF572 9..325 CDD:398281 77/320 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1583452at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.