DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbk and lrg1

DIOPT Version :10

Sequence 1:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster
Sequence 2:XP_004911101.1 Gene:lrg1 / 116406453 XenbaseID:XB-GENE-984373 Length:372 Species:Xenopus tropicalis


Alignment Length:322 Identity:101/322 - (31%)
Similarity:146/322 - (45%) Gaps:47/322 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 CPKDCKC---LNVLFDCDKLHLERVPVLPSYVQTLHLANNKLNDTTVLEIRN-----LLNLTKVS 321
            ||..|.|   ||:...|....|:..|.  |:  .||..:..:..|.:..:.|     |.||.::.
 Frog    61 CPSLCNCTSSLNISVVCISRELDSFPC--SF--PLHTISISVEFTNITSLCNGSFSELPNLQELH 121

  Fly   322 LKRNLLEVIP--KFIGLSGLKHLVLANNHITSISSESLAALPLLRTLDLSRNKLHTIELNSFPKS 384
            |..|.|:.:|  .|:.||.|..|.|.||.|.|::......:|.||.|.|..|.|..:.::.....
 Frog   122 LSNNALQSLPIQFFVPLSSLHTLDLTNNLIQSVTPTLFLDVPALRFLVLRGNLLTKLWISKISIL 186

  Fly   385 NNLVHLILSFNEITNVNEHSFATLNNLTDLELSNNRLSTLPIRVFKNLNQLKKLALNFNQL-EIN 448
            .||..|.||.|.:..||..||::||||.:|:||.|:|..||..:.|.|..|::|.|..|.| .:.
 Frog   187 KNLNWLDLSHNHLKEVNSMSFSSLNNLENLDLSYNQLHQLPSSLLKGLPLLQRLNLEGNNLSSLP 251

  Fly   449 WSTFRGLESMKNLQLKSNKIRALQDGVFYVMHKIETIDLAMNQISSLSRQGLFNLTKLRHLNLSF 513
            ...|.....:|::.|..|.:..|..|:...:..::|:||:.|.:.||. .|.  |.:.:.||   
 Frog   252 SDFFAATPFLKHVFLARNSLHFLPKGLLLPVMSLKTLDLSENMLKSLP-SGF--LLESKGLN--- 310

  Fly   514 NAISRIEVDTWEFTQSLEVLDLSNNAINEFKPQHLDC----LHRLKTLNLAHNRLQYLQENT 571
                    |:.|     :.||||||      |.|.||    ||:..|   .|....|..:||
 Frog   311 --------DSME-----QTLDLSNN------PWHCDCHLLSLHQWVT---KHKHTLYFIDNT 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbkNP_611091.2 LRR <293..642 CDD:443914 91/291 (31%)
leucine-rich repeat 293..316 CDD:275380 5/27 (19%)
leucine-rich repeat 317..338 CDD:275380 7/22 (32%)
leucine-rich repeat 339..362 CDD:275380 7/22 (32%)
leucine-rich repeat 363..386 CDD:275380 6/22 (27%)
leucine-rich repeat 387..410 CDD:275380 10/22 (45%)
leucine-rich repeat 411..434 CDD:275380 10/22 (45%)
leucine-rich repeat 435..457 CDD:275380 6/22 (27%)
leucine-rich repeat 458..481 CDD:275380 5/22 (23%)
leucine-rich repeat 482..505 CDD:275380 8/22 (36%)
leucine-rich repeat 506..529 CDD:275380 4/22 (18%)
leucine-rich repeat 530..553 CDD:275380 11/26 (42%)
leucine-rich repeat 554..577 CDD:275380 5/18 (28%)
leucine-rich repeat 578..604 CDD:275380
leucine-rich repeat 607..630 CDD:275380
leucine-rich repeat 631..652 CDD:275380
LRRCT 665..712 CDD:214507
Ig_3 717..816 CDD:464046
Ig 835..924 CDD:472250
Ig strand B 851..855 CDD:409353
Ig strand C 864..868 CDD:409353
Ig strand E 890..894 CDD:409353
Ig strand F 904..909 CDD:409353
Ig strand G 917..920 CDD:409353
Ig_3 927..1013 CDD:464046
lrg1XP_004911101.1 LRR <107..363 CDD:443914 88/272 (32%)
leucine-rich repeat 117..140 CDD:275380 7/22 (32%)
leucine-rich repeat 141..164 CDD:275380 7/22 (32%)
leucine-rich repeat 165..188 CDD:275380 6/22 (27%)
leucine-rich repeat 189..212 CDD:275380 10/22 (45%)
leucine-rich repeat 213..236 CDD:275380 10/22 (45%)
leucine-rich repeat 237..260 CDD:275380 6/22 (27%)
leucine-rich repeat 261..284 CDD:275380 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.