DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbk and Chadl

DIOPT Version :10

Sequence 1:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster
Sequence 2:NP_001419062.1 Gene:Chadl / 100910434 RGDID:6504353 Length:737 Species:Rattus norvegicus


Alignment Length:692 Identity:147/692 - (21%)
Similarity:227/692 - (32%) Gaps:252/692 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 CPKDCKCLNVL--FDCDKLHLERVP-VLPSYVQT------------------------------- 295
            ||:.|.|.|..  ..|...:|..|| .:|...|.                               
  Rat    27 CPQTCVCDNSRRHVTCQHQNLTEVPDTIPELTQRLDLQGNMLKVIPPAAFQDLPYLTHLDLQHCQ 91

  Fly   296 -----------------LHLANNKLNDTTVLEIRNLLNLTKVSLKRNLLE--------------- 328
                             |:||:|:|:......:..|.:|.::.|:||:||               
  Rat    92 VEQVAEGAFRGLGRLLFLNLASNRLSSLPQEALDGLGSLRRLELERNMLEELRPGTFGALGSLAT 156

  Fly   329 ---------VIP--KFIGLSGLKHLVLANNHITSISSESLAALPLLRTLDLSRNKLHTIELNSFP 382
                     .:|  .|.||...:.|.|::|.::.::.|:||.||:||.|.|..|:|..:...:..
  Rat   157 LNLAHNALVYLPAMAFQGLMRTRWLQLSHNALSVLAPEALAGLPVLRRLSLHHNELQALPGAALS 221

  Fly   383 KSNNLVHLILSFNEITNVNE------------------------HSFATLNNLTDLELSNNRLST 423
            ::.:|..|.|..|.:|...|                        .:||....|..|:|..|:|:|
  Rat   222 QARSLARLELGHNPLTYTGEEDGLALPGLRELALDHGSLQALGPRAFAHCPRLHTLDLRGNQLTT 286

  Fly   424 L-PIRVFKNLNQLKKLALNFNQL------------------------------------------ 445
            | |::|   ..||::|.|..|.|                                          
  Rat   287 LPPLQV---PGQLRRLRLQGNPLWCACHARPLLEWLVRARVRSDGACRGPRRLRGETLDTLRPSD 348

  Fly   446 ----------------------------EINWST------------------------------- 451
                                        |..|:|                               
  Rat   349 LRCPGDAAEDEDEDRPAGPRSPPRSLHEEARWATPCPPACVCVGETRHSACDGRGLQAVPRGFPN 413

  Fly   452 -------------------FRGLESMKNLQLKSNKIRALQDGVFYVMHKIETIDLAMNQISSLSR 497
                               |.||..:.:|.|:...|..|:.|....:..:..:.|:.||:|.||.
  Rat   414 DTQLLDLRRNHFPSVPRAAFPGLRHLVSLHLQHCGIAELEPGALAGLDGLVYLYLSNNQLSGLSA 478

  Fly   498 QGLFNLTKLRHLNLSFNAISRIEVDTWEFTQSLEVLDLSNNAINEFKPQHLDCLHRLKTLNLAHN 562
            ..|.....|.:|.|..|...||..........|..|.|.:||::...|..|.....|:.|.|:.|
  Rat   479 AALEGAPNLGYLYLEHNRFLRIPGAALRALPRLFSLHLQDNAVDRLAPGDLAGARALRGLYLSGN 543

  Fly   563 RLQYLQENTFDCVKNLEELNLRRNRLSWI-----------IEDQSAAAPFKGL---------RKL 607
            .:..:........:.||:|:|.||:|..:           .|.|.:..||:.|         |.|
  Rat   544 HITQVSPGALGPARELEKLHLDRNQLRQVPTGALEGLPALKELQLSRNPFRALHDGAFQPVGRSL 608

  Fly   608 RRLDLHGNNLKQISTKAMSGL-NNLEILNLGSNALASIQVNAFEHMLRLNKLVFKSLN-FICDCD 670
            ::|.|:.::|:|||.:|.||| ..|:.|.|..|.|.|:....:...|.|..|   |.| |.|||.
  Rat   609 QQLFLNSSDLEQISPRAFSGLGKGLQGLYLQQNQLQSLPAPMWLSGLELIDL---SGNPFHCDCQ 670

  Fly   671 LVWFQQWLKNRFPQQAEHAVCGYPEHLLDRHLKSLSSSELVC 712
            |:...:||...  .....|.|..|..:..:.:|:.:|....|
  Rat   671 LLPLHRWLTGL--NLRVGATCATPPSVRGQKVKAAASVFEAC 710

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbkNP_611091.2 LRR <293..642 CDD:443914 117/588 (20%)
leucine-rich repeat 293..316 CDD:275380 7/70 (10%)
leucine-rich repeat 317..338 CDD:275380 10/46 (22%)
leucine-rich repeat 339..362 CDD:275380 7/22 (32%)
leucine-rich repeat 363..386 CDD:275380 6/22 (27%)
leucine-rich repeat 387..410 CDD:275380 8/46 (17%)
leucine-rich repeat 411..434 CDD:275380 9/23 (39%)
leucine-rich repeat 435..457 CDD:275380 11/141 (8%)
leucine-rich repeat 458..481 CDD:275380 5/22 (23%)
leucine-rich repeat 482..505 CDD:275380 7/22 (32%)
leucine-rich repeat 506..529 CDD:275380 6/22 (27%)
leucine-rich repeat 530..553 CDD:275380 7/22 (32%)
leucine-rich repeat 554..577 CDD:275380 4/22 (18%)
leucine-rich repeat 578..604 CDD:275380 11/36 (31%)
leucine-rich repeat 607..630 CDD:275380 11/23 (48%)
leucine-rich repeat 631..652 CDD:275380 6/20 (30%)
LRRCT 665..712 CDD:214507 12/46 (26%)
Ig_3 717..816 CDD:464046
Ig 835..924 CDD:472250
Ig strand B 851..855 CDD:409353
Ig strand C 864..868 CDD:409353
Ig strand E 890..894 CDD:409353
Ig strand F 904..909 CDD:409353
Ig strand G 917..920 CDD:409353
Ig_3 927..1013 CDD:464046
ChadlNP_001419062.1 LRRNT 27..59 CDD:214470 10/31 (32%)
leucine-rich repeat 38..56 CDD:275380 4/17 (24%)
leucine-rich repeat 58..81 CDD:275380 1/22 (5%)
LRR 61..>306 CDD:443914 52/247 (21%)
leucine-rich repeat 82..105 CDD:275380 0/22 (0%)
leucine-rich repeat 106..129 CDD:275380 6/22 (27%)
leucine-rich repeat 130..153 CDD:275380 6/22 (27%)
leucine-rich repeat 154..177 CDD:275380 4/22 (18%)
leucine-rich repeat 178..201 CDD:275380 7/22 (32%)
leucine-rich repeat 202..225 CDD:275380 6/22 (27%)
leucine-rich repeat 226..249 CDD:275380 6/22 (27%)
leucine-rich repeat 250..273 CDD:275380 2/22 (9%)
leucine-rich repeat 296..335 CDD:275380 5/38 (13%)
LRRNT 383..417 CDD:214470 0/33 (0%)
leucine-rich repeat 415..438 CDD:275380 3/22 (14%)
LRR <418..>638 CDD:443914 58/219 (26%)
leucine-rich repeat 439..462 CDD:275380 5/22 (23%)
leucine-rich repeat 463..486 CDD:275380 7/22 (32%)
leucine-rich repeat 487..510 CDD:275380 6/22 (27%)
leucine-rich repeat 511..534 CDD:275380 7/22 (32%)
leucine-rich repeat 535..558 CDD:275380 4/22 (18%)
leucine-rich repeat 559..582 CDD:275380 7/22 (32%)
leucine-rich repeat 583..607 CDD:275380 5/23 (22%)
leucine-rich repeat 608..631 CDD:275380 11/22 (50%)
leucine-rich repeat 633..655 CDD:275380 6/21 (29%)
leucine-rich repeat 656..667 CDD:275378 5/13 (38%)
LRRCT 663..711 CDD:214507 14/50 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.