DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CysRS and YNL247W

Sequence 1:NP_611087.1 Gene:CysRS FlyBaseID:FBgn0027091 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_014152.1 Gene:YNL247W SGDID:S000005191 Length:767 Species:Saccharomyces cerevisiae

Alignment Length:782 Identity:343/783 (44%)
Similarity:462/783 (59%) Gaps:93/783 (12%)


  Fly     6 QPAW-----QAPEAVDRPKLKLFNSLTRQKEDFVPLDGN-NVTWYSCGPTVYDASHMGHARSYIS 64
            ||.|     ||.|.|    |||:|||||.|.:|:|..|| .||||||||||||||||||||:|:|
Yeast    21 QPKWKVPTPQAKETV----LKLYNSLTRSKVEFIPQSGNRGVTWYSCGPTVYDASHMGHARNYVS 81

  Fly    65 FDILRRILSDYFGYNIHYVMNITDIDDKIIRRARQNHLFDEYAAEAQ-----------KLPLDEL 118
            .||.|||:.|||||::.:|.|:||||||||.|||||:|||.:..|..           |..|.:.
Yeast    82 IDINRRIIQDYFGYDVQFVQNVTDIDDKIILRARQNYLFDNFVKENDTKFNATVVDKVKTALFQY 146

  Fly   119 L-------GQQKEVLQRFQDTCAKNTDPDKKIMLDKTLQRMN-----------DAVEALTKAVGK 165
            :       |.:.:.::.| :|...|.|.:       ||:..|           :|:|::||  |.
Yeast   147 INKNFTIQGSEIKTIEEF-ETWLSNADTE-------TLKLENPKFPMHVTAVQNAIESITK--GD 201

  Fly   166 GDEREISEKRLLYLNEAKDPISDWLDSLKGAQINDNAVFEALPRYWEDQFHNDMKSLNILPPDVL 230
            ..:.|::      ..:.||.....||...|:.|::..:|..||.|||.:|::||.|||:|||.|.
Yeast   202 SMDAEVA------FEKVKDVTVPLLDKELGSTISNPEIFRQLPAYWEQKFNDDMLSLNVLPPTVT 260

  Fly   231 TRVSEYVPQIVTFIQKIIDNGLAYA-ANNSVYFDVNGFDKREKHHYAKLVPEAYGDTKSLQEGEG 294
            ||||||||:|:.|:|||||||.||| ::.|||||...|||...|.|||..|...|....:.:|||
Yeast   261 TRVSEYVPEIIDFVQKIIDNGYAYATSDGSVYFDTLKFDKSPNHDYAKCQPWNKGQLDLINDGEG 325

  Fly   295 DLSIAEDRLSEKRSANDFALWKASKAGEPWWDSPWGKGRPGWHIECSAMASDIFGPTFDIHTGGV 359
            .||...|  :.|:|.||||||||||||||.|:|||||||||||||||.|||||.|...|||:||:
Yeast   326 SLSNFAD--NGKKSNNDFALWKASKAGEPEWESPWGKGRPGWHIECSVMASDILGSNIDIHSGGI 388

  Fly   360 DLKFPHHDNELAQSEAAFNESEWVKYFLHTGHLTIAGCKMSKSLKNFVTIQEALKKHSATQLRLA 424
            ||.|||||||||||||.|:..:|:.||||||||.|.|.|||||||||:||||||||.|..|||||
Yeast   389 DLAFPHHDNELAQSEARFDNQQWINYFLHTGHLHIEGQKMSKSLKNFITIQEALKKFSPRQLRLA 453

  Fly   425 FLLHSWKDTLDYSENTMEMATQYEKFLNEFFLNVKDLTR------HVLSEEPRRQFDAWTEVEAA 483
            |....|.:.||:.|:.:.....:|..:|.||..::.|..      |:..:        ::.:|..
Yeast   454 FASVQWNNQLDFKESLIHEVKSFENSMNNFFKTIRALKNDAASAGHISKK--------FSPLEKE 510

  Fly   484 LQKKFSNAQVQVHASLCDNIDTRSALDAIRELVSVSNVYIRDNKTRLNSLLLRNVATYITDLLHV 548
            |...|..::.:||::.|||:.|..||..:.|||:.||.||......|....|..:.:|||.:|.:
Yeast   511 LLADFVESESKVHSAFCDNLSTPVALKTLSELVTKSNTYITTAGAALKIEPLIAICSYITKILRI 575

  Fly   549 FGAISGPRGGIGFPVSGGSGAQAAGADLETTVLPYVQSLAEFRYLVREQA-KTLKAFDILKLCDD 612
            .|..|.| ..:|:....||...:.|: ||.||:|||:.|:.||..||..| |..:..:.|:|.|.
Yeast   576 IGFPSRP-DNLGWAAQAGSNDGSLGS-LEDTVMPYVKCLSTFRDDVRSLAIKKAEPKEFLQLTDK 638

  Fly   613 LRDNVLPNLGVRLEDKDIGKYAVKLVDRDSLL------REREAKLAAEAEKAAEKERKKQAAAEA 671
            :|:..|.||.|.|:|::.....:|.:..|..|      .|:.|...|:.:|..|:::.::     
Yeast   639 IRNEDLLNLNVALDDRNGQSALIKFLTNDEKLEIVKLNEEKHANELAKKQKKLEQQKLRE----- 698

  Fly   672 AAAKEAQRR----VNPKEMFLAETEKYSAFDENGLPTHDKEGKEVSKGQIKKLQKLQQQQEQRYN 732
              .||.:|:    :.|::|| .:...|||:||.||||.||:|.:::|...|||:|..:||::.:.
Yeast   699 --QKENERKQKAQIKPQDMF-KDVTLYSAWDEQGLPTKDKDGNDITKSMTKKLKKQWEQQKKLHE 760

  Fly   733 EY 734
            ||
Yeast   761 EY 762

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CysRSNP_611087.1 PTZ00399 2..737 CDD:240402 343/783 (44%)
CysRS_core 21..437 CDD:173899 238/447 (53%)
YNL247WNP_014152.1 PTZ00399 2..762 CDD:240402 342/781 (44%)
CysRS_core 37..465 CDD:173899 238/446 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C136825933
eggNOG 1 0.900 E1_COG0215
Hieranoid 1 1.000
Homologene 1 1.000 H1328
Inparanoid 1 1.050 594 1.000 Inparanoid score I133
Isobase 1 0.950 0 Normalized mean entropy S696
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004329
OrthoInspector 1 1.000 T1135927
orthoMCL 1 0.900 OOG5_126755
Panther 1 1.100 LDO PTHR10890
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1431
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.