DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CysRS and AT5G38830

Sequence 1:NP_611087.1 Gene:CysRS FlyBaseID:FBgn0027091 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_198699.1 Gene:AT5G38830 AraportID:AT5G38830 Length:511 Species:Arabidopsis thaliana

Alignment Length:648 Identity:185/649 (29%)
Similarity:282/649 (43%) Gaps:181/649 (28%)


  Fly    16 DRPKLKLFNSLTRQKEDFVPLDGNNVTWYSCGPTVYDASHMGHARSYISFDILRRILSDYFGYNI 80
            ::.:|||:|::|:|||..:|:....:..|.||.|.||.||:||||:.:|||:|.|.|. :..|::
plant     4 EKMELKLYNTMTQQKEVLIPITPGKIGLYVCGITAYDFSHIGHARAAVSFDVLYRYLK-HLDYDV 67

  Fly    81 HYVMNITDIDDKIIRRARQNHLFDEYAAEAQKLPLDELLGQQKEVLQRFQDTCAKNTDPDKKIML 145
            .:|.|.||:|||||.||.:|                                             
plant    68 TFVRNFTDVDDKIIDRANKN--------------------------------------------- 87

  Fly   146 DKTLQRMNDAVEALTKAVGKGDEREISEKRLLYLNEAKDPISDWLDSLKGAQINDNAVFEALPRY 210
                                                .:||:.                   |...
plant    88 ------------------------------------GEDPLD-------------------LSNR 97

  Fly   211 WEDQFHNDMKSLNILPPDVLTRVSEYVPQIVTFIQKIIDNGLAYAANNSVYFDVNGFDKREKHHY 275
            :.|::..||.:|..|||....||||::..|:..|:|||:....|.....|:|.|:     :..:|
plant    98 FCDEYLVDMGALQCLPPTHQPRVSEHMDNIIKMIEKIIEKDCGYVVEGDVFFSVD-----KSPNY 157

  Fly   276 AKLVPEAYGDTKSLQEGEGDLSIAEDRLSEKRSANDFALWKASKAGEPWWDSPWGKGRPGWHIEC 340
            .||..:....|::   ||   .:|.|  |.||:..|||||||:|..||.|:||||.|||||||||
plant   158 GKLSGQLLEHTRA---GE---RVAVD--SRKRNPADFALWKAAKPDEPSWESPWGPGRPGWHIEC 214

  Fly   341 SAMASDIFGPTFDIHTGGVDLKFPHHDNELAQSEAAFNESEWVKYFLHTGHLTIAGCKMSKSLKN 405
            |||:.....|.||||.||.|||||||:||:||:.||..:| .|.|:||.||:||...||:||..|
plant   215 SAMSVHYLSPKFDIHGGGADLKFPHHENEIAQTCAACEDS-GVNYWLHNGHVTINNEKMAKSKHN 278

  Fly   406 FVTIQEALKKHSATQLRLAFLLHSWKDTLDYSENTMEMATQYEKFLNEFFLNVKDLT------RH 464
            |.||:|....:....||...:...::..|.::.:.:|.:::   .|...:..::||.      :.
plant   279 FKTIREITASYHPLALRHFLMSAQYRSPLSFTASQLESSSE---ALYYVYQTLQDLDEGLSPYQD 340

  Fly   465 VLSEEPRRQFDAWTEVEAALQKKFSNAQVQVHASLCDNIDTRSAL-----DAIREL-VSVSNVYI 523
            .|||:..:     :|..|..:......:.:..:.:.|:::|...|     ||::.: .|:|.:..
plant   341 ALSEDGGK-----SEQTAEGKDIIKKLKTEFESKMLDDLNTAHILTGAYQDALKFINASLSKLKK 400

  Fly   524 RDNKTRLNSLL-LRNVATYITDLLHVFGAISGPRGGIGFPVSGGSGAQAAGADLETTVLPYVQSL 587
            ...|.|::.|: |..:.....::|.|.|.:                          |.|.|.:.|
plant   401 MQKKQRMSMLVSLVEIEKAAREVLDVLGLL--------------------------TTLSYAEIL 439

  Fly   588 AEFR---------------YLVREQAKTLKAFDILKLCDDLRDNVLPNLGVRLEDKDIGKYAV 635
            .|.:               .|:.|:....|..|..| .|::|:. |...|:.|  .||||..|
plant   440 KEMKLKTLIRAEIGEEGISQLIEERITARKNKDFAK-SDEIREK-LTRKGIAL--MDIGKETV 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CysRSNP_611087.1 PTZ00399 2..737 CDD:240402 185/649 (29%)
CysRS_core 21..437 CDD:173899 141/416 (34%)
AT5G38830NP_198699.1 cysS 6..500 CDD:234705 185/647 (29%)
CysRS_core 9..310 CDD:173899 141/416 (34%)
Anticodon_Ia_like 313..500 CDD:299868 43/225 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 291 1.000 Inparanoid score I810
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D528822at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126755
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.932 Consistency score
43.870

Return to query results.
Submit another query.