DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CysRS and AT3G56300

Sequence 1:NP_611087.1 Gene:CysRS FlyBaseID:FBgn0027091 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_191189.1 Gene:AT3G56300 AraportID:AT3G56300 Length:489 Species:Arabidopsis thaliana

Alignment Length:629 Identity:181/630 (29%)
Similarity:263/630 (42%) Gaps:204/630 (32%)


  Fly    15 VDRPKLKLFNSLTRQKEDFVPLDGNNVTWYSCGPTVYDASHMGHARSYISFDILRRILSDYFGYN 79
            |::|.|.|:|::|:.||.:.|::...:..|.||.|.||.||:||||:.:|||:|.|.|. :.||.
plant     6 VEKPDLTLYNTMTQLKEVYKPMNPGKIGIYVCGITAYDYSHIGHARAAVSFDLLYRYLR-HLGYQ 69

  Fly    80 IHYVMNITDIDDKIIRRARQNHLFDEYAAEAQKLPLDELLGQQKEVLQRFQDTCAKNTDPDKKIM 144
            :.||.|.||:|||              |....:.|||        :..||   |           
plant    70 VTYVRNFTDVDDK--------------AKNCGEKPLD--------LSNRF---C----------- 98

  Fly   145 LDKTLQRMNDAVEALTKAVGKGDEREISEKRLLYLNEAKDPISDWLDSLKGAQINDNAVFEALPR 209
                                        |:.||                                
plant    99 ----------------------------EEYLL-------------------------------- 103

  Fly   210 YWEDQFHNDMKSLNILPPDVLTRVSEYVPQIVTFIQKIIDNGLAYAANNSVYFDVNGFDKREKHH 274
                    ||.:|..|.|....|||:::.||:..|:|||:||..||....|:|.|   ||...  
plant   104 --------DMAALQCLLPTHQPRVSDHMEQIIKMIEKIIENGCGYAVGGDVFFSV---DKSPS-- 155

  Fly   275 YAKLVPEAYGDTKSLQEGEGDLSIAEDRLSEKRSANDFALWKASKAGEPWWDSPWGKGRPGWHIE 339
            |.:|..:....|   |.|:   .:|.|  |.||:..||||.||:|:|||.|:||||.||||||||
plant   156 YGQLSGQRLDHT---QAGK---RVAVD--SRKRNPADFALRKAAKSGEPSWESPWGHGRPGWHIE 212

  Fly   340 CSAMASDIFGPTFDIHTGGVDLKFPHHDNELAQSEAAFNESEWVKYFLHTGHLTIAGCKMSKSLK 404
                        ||||.||.|||||||:||:||:.||..:| .|.|:||.||:|....||.|||.
plant   213 ------------FDIHGGGADLKFPHHENEIAQTCAACEDS-GVNYWLHNGHVTNNNVKMGKSLN 264

  Fly   405 NFVTIQEALKKHSATQLRLAFLLHSWKDTLDYSENTMEMATQYEKFLNEFFLNVKDLTRHVLSEE 469
            ||.||::....:....||...:...::..|:||.:.:|.::.                 .:.|..
plant   265 NFFTIRQIAANYHPLALRHFLMSAQYRSPLNYSVSQLESSSD-----------------ALYSLS 312

  Fly   470 PRRQFDAWTEVEAALQKKFSNAQVQVHASLCDNIDTRSALDAIRELVSVSNVYIRDNKTRLNSLL 534
            |.|:     |:...:.|...:|:.:....     ..::||..|.  ||:|.:.....|.|::.::
plant   313 PYRE-----EMSGDVGKTQQSAEAKEMIK-----KVKNALKFIN--VSISKLKKMQKKQRMSLVV 365

  Fly   535 -LRNVATYITDLLHVFGAISG---------------PRGGIGFPVSGGSGAQAAGADLETTVLPY 583
             |..|...:.::|.|.|.::.               .|.|:|                |..||..
plant   366 SLVEVEKAVREVLDVLGLLTTLSYGELLKDMKQKALTRAGMG----------------EEEVLQR 414

  Fly   584 VQSLAEFRYLVREQAKTLKAFDILKLCDDLRDNVLPNLGVRLED 627
            ::.        |..|:..|.|   :..|.:|: :|...|:.|||
plant   415 IEE--------RNMARKSKDF---RRSDRIRE-LLAFKGIFLED 446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CysRSNP_611087.1 PTZ00399 2..737 CDD:240402 181/630 (29%)
CysRS_core 21..437 CDD:173899 140/416 (34%)
AT3G56300NP_191189.1 cysS 11..454 CDD:234705 179/625 (29%)
CysRS_core 12..297 CDD:173899 140/416 (34%)
Anticodon_Ia_like <398..454 CDD:299868 17/78 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 291 1.000 Inparanoid score I810
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D528822at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126755
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.929 Consistency score
43.870

Return to query results.
Submit another query.