DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CysRS and SYCO ARATH

Sequence 1:NP_611087.1 Gene:CysRS FlyBaseID:FBgn0027091 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_565717.2 Gene:SYCO ARATH AraportID:AT2G31170 Length:563 Species:Arabidopsis thaliana

Alignment Length:643 Identity:192/644 (30%)
Similarity:288/644 (45%) Gaps:188/644 (29%)


  Fly    19 KLKLFNSLTRQKEDFVPLDGNNVTWYSCGPTVYDASHMGHARSYISFDILRRILSDYFGYNIHYV 83
            :|.|.|:::|:||.|.|.....|..|.||.|.||.||:||||.|::||:|.|.|. :.||.:.||
plant    64 ELWLHNTMSRKKELFKPKVEGKVGMYVCGVTAYDLSHIGHARVYVTFDVLLRYLK-HLGYEVSYV 127

  Fly    84 MNITDIDDKIIRRARQNHLFDEYAAEAQKLPLDELLGQQKEVLQRFQDTCAKNTDPDKKIMLDKT 148
            .|.||:|||||.||::               |:|                               
plant   128 RNFTDVDDKIIARAKE---------------LEE------------------------------- 146

  Fly   149 LQRMNDAVEALTKAVGKGDEREISEKRLLYLNEAKDPISDWLDSLKGAQINDNAVFEALPRYWED 213
                                               ||||                   |.|.:.:
plant   147 -----------------------------------DPIS-------------------LSRRFCE 157

  Fly   214 QFHNDMKSLNILPPDVLTRVSEYVPQIVTFIQKIIDNGLAYAANNSVYFDVNGFDKREKHHYAKL 278
            :|:.||:.|..|.|.|..|||:::|||:..|::|:|||.||..:..:||.|:.|..     |.||
plant   158 EFNRDMEQLQCLDPSVQPRVSDHIPQIIDLIKQILDNGYAYKVDGDIYFSVDKFPT-----YGKL 217

  Fly   279 VPEAYGDTKSLQEGEGDLSIAEDRLSEKRSANDFALWKASKAGEPWWDSPWGKGRPGWHIECSAM 343
                  ..:.|::......:|.|  :.|:...|||||||:|.|||:|:||||:||||||||||||
plant   218 ------SGRKLEDNRAGERVAVD--TRKKHPADFALWKAAKEGEPFWESPWGRGRPGWHIECSAM 274

  Fly   344 ASDIFGPTFDIHTGGVDLKFPHHDNELAQSEAAFNESEWVKYFLHTGHLTIAGCKMSKSLKNFVT 408
            ::...|.:||||.||:||.||||:||:|||.||.:.|. :.|::|.|.:|:...||||||.||.|
plant   275 SAAYLGYSFDIHGGGMDLVFPHHENEIAQSCAACDSSN-ISYWIHNGFVTVDSEKMSKSLGNFFT 338

  Fly   409 IQEALKKHSATQLRLAFLLHSWKDTLDYSENTMEMATQYEKFLNEFFLNVKDLTRHVLSEEPRRQ 473
            |::.:..:....|||..:...::..::||:..:|.|::...::.:        |.|         
plant   339 IRQVIDLYHPLALRLFLMGTHYRSPINYSDFLLESASERIFYIYQ--------TLH--------- 386

  Fly   474 FDAWTEVEAALQKK---FSNAQV-------------QVHASLCDNIDTRSALDAIRELVSVSNVY 522
                 :.|:||.:|   |.|..|             :..||:.|::.|...|.|:.|.:...|..
plant   387 -----DCESALGEKDSTFENGSVPSDTLTSINTFRTEFVASMSDDLLTPVTLAAMSEPLKTINDL 446

  Fly   523 IRDNKTRLNSL---LLRNVATYITDLLHVFGAISGPRGGIGFPVSGGSGAQAAGADLETTVLPYV 584
            |...|.:..:.   .|:.:.|.|.|:|.:.|.:         |.|                  |.
plant   447 IHTRKGKKQARREESLKALETTIRDVLTILGLM---------PTS------------------YS 484

  Fly   585 QSLAEFRYLVREQAKTLKAFDILKLCDDLRDNVLPNLGVRLED---KDIGKYAVKLVD 639
            :.|.:.:....::| .||..|:|:...: |.:...|......|   ||:.|..:.|:|
plant   485 EVLEQLKEKALKRA-GLKEEDVLQRVQE-RTDARKNKEYERSDAIRKDLAKVGIALMD 540

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CysRSNP_611087.1 PTZ00399 2..737 CDD:240402 192/644 (30%)
CysRS_core 21..437 CDD:173899 146/416 (35%)
SYCO ARATHNP_565717.2 PLN02946 6..562 CDD:178532 192/644 (30%)
CysRS_core 66..367 CDD:173899 146/416 (35%)
Anticodon_Ia_like 380..548 CDD:299868 42/213 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H1328
Inparanoid 1 1.050 291 1.000 Inparanoid score I810
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D528822at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126755
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.