DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CysRS and CARS2

Sequence 1:NP_611087.1 Gene:CysRS FlyBaseID:FBgn0027091 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_078813.1 Gene:CARS2 HGNCID:25695 Length:564 Species:Homo sapiens

Alignment Length:669 Identity:214/670 (32%)
Similarity:306/670 (46%) Gaps:163/670 (24%)


  Fly     4 RGQPAWQAPEAVDRPKLKLFNSLTRQKEDFVPLDGNNVTWYSCGPTVYDASHMGHARSYISFDIL 68
            ||: ||..|...: ..::::||||.:||..:.......:||||||||||.:|:|||.||:.|||:
Human    38 RGR-AWLQPTGRE-TGVQVYNSLTGRKEPLIVAHAEAASWYSCGPTVYDHAHLGHACSYVRFDII 100

  Fly    69 RRILSDYFGYNIHYVMNITDIDDKIIRRARQNHLFDEYAAEAQKLPLDELLGQQKEVLQRFQDTC 133
            ||||:..||.:|..||.|||:|||||:||                                    
Human   101 RRILTKVFGCSIVMVMGITDVDDKIIKRA------------------------------------ 129

  Fly   134 AKNTDPDKKIMLDKTLQRMNDAVEALTKAVGKGDEREISEKRLLYLNEAKDPISDWLDSLKGAQI 198
                                             :|..||...|..|                   
Human   130 ---------------------------------NEMNISPASLASL------------------- 142

  Fly   199 NDNAVFEALPRYWEDQFHNDMKSLNILPPDVLTRVSEYVPQIVTFIQKIIDNGLAYA-ANNSVYF 262
                        :|:.|..||.:|.:|||.|..||:|.:|||::||:.||..|.||: |..:|||
Human   143 ------------YEEDFKQDMAALKVLPPTVYLRVTENIPQIISFIEGIIARGNAYSTAKGNVYF 195

  Fly   263 DVNGFDKREKHHYAKLVPEAYGDTKSLQEGEGDLSIAEDRLSEKRSANDFALWKASKAGEPWWDS 327
            |:    |.....|.|||....|            .:.|...|:||.|:|||||||:|..|.:|.|
Human   196 DL----KSRGDKYGKLVGVVPG------------PVGEPADSDKRHASDFALWKAAKPQEVFWAS 244

  Fly   328 PWGKGRPGWHIECSAMASDIFGPTFDIHTGGVDLKFPHHDNELAQSEAAFNESEWVKYFLHTGHL 392
            |||.|||||||||||:||.:||...|||:||:||.||||:||:||.|......:|..||||:|||
Human   245 PWGPGRPGWHIECSAIASMVFGSQLDIHSGGIDLAFPHHENEIAQCEVFHQCEQWGNYFLHSGHL 309

  Fly   393 TIAGC--KMSKSLKNFVTIQEALKKHSATQLRLAFLLHSWKDTLDYSENTMEMATQYEKFLNEFF 455
            ...|.  ||||||||::||::.||..|....|...|..|::..:|||::.|..|.|....|..| 
Human   310 HAKGKEEKMSKSLKNYITIKDFLKTFSPDVFRFFCLRSSYRSAIDYSDSAMLQAQQLLLGLGSF- 373

  Fly   456 LNVKDLTRHVLSEEPRRQFDAWTEVEAALQKKFSNAQVQVHASLCDNIDTRSALDAIRELVSVSN 520
              ::|...::     :.|....:..||.|.::.|:.:..|.|:|.|:.||...:|||..|....|
Human   374 --LEDARAYM-----KGQLACGSVREAMLWERLSSTKRAVKAALADDFDTPRVVDAILGLAHHGN 431

  Fly   521 VYIR----DNKTRLNSLLLRNVATYITDLLHVFGAISGPRGGIGFPVSGGSGAQAAGADLETTVL 581
            ..:|    :.:...:..:...:.:|........|            :|..:....:|...|.|:.
Human   432 GQLRASLKEPEGPRSPAVFGAIISYFEQFFETVG------------ISLANQQYVSGDGSEATLH 484

  Fly   582 PYVQSLAEFRYLVREQA-------------KTLKAFDILKLCDDLRDNVLPNLGVRLEDKDIGKY 633
            ..|..|..||..||:.|             :.|:...:|:.||.||..:..: |:.::|:.....
Human   485 GVVDELVRFRQKVRQFALAMPEATGDARRQQLLERQPLLEACDTLRRGLTAH-GINIKDRSSTTS 548

  Fly   634 AVKLVDRDSLLREREAKLA 652
            ..:|:|:    |.::.|.|
Human   549 TWELLDQ----RTKDQKSA 563

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CysRSNP_611087.1 PTZ00399 2..737 CDD:240402 214/670 (32%)
CysRS_core 21..437 CDD:173899 159/419 (38%)
CARS2NP_078813.1 CysS 53..553 CDD:223293 205/637 (32%)
CysRS_core 53..356 CDD:173899 159/419 (38%)
'HIGH' region 80..90 7/10 (70%)
'KMSKS' region 317..321 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D480663at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126755
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.