DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CysRS and Cars2

Sequence 1:NP_611087.1 Gene:CysRS FlyBaseID:FBgn0027091 Length:741 Species:Drosophila melanogaster
Sequence 2:XP_011240384.1 Gene:Cars2 MGIID:1919191 Length:619 Species:Mus musculus

Alignment Length:739 Identity:222/740 (30%)
Similarity:317/740 (43%) Gaps:251/740 (34%)


  Fly     1 MSKRGQPAWQAPEAVDRPKLKLFNSLTRQKEDFVPLDGNNVTWYSCGPTVYDASHMGHARSYISF 65
            :.:||: :||.|:..| ..:::.||||.:||..:....:.|:||||||||||.:|:|||.||:.|
Mouse    20 LGRRGR-SWQRPQGQD-TGVQVHNSLTGRKEPLIVARSDAVSWYSCGPTVYDHAHLGHACSYVRF 82

  Fly    66 DILRRILSDYFGYNIHYVMNITDIDDKIIRRARQNHLFDEYAAEAQKLPLDELLGQQKEVLQRFQ 130
            ||:||||:..||.|:...|:|||:|||||:||.:                               
Mouse    83 DIIRRILTRVFGCNVVMAMSITDVDDKIIKRANE------------------------------- 116

  Fly   131 DTCAKNTDPDKKIMLDKTLQRMNDAVEALTKAVGKGDEREISEKRLLYLNEAKDPISDWLDSLKG 195
                                 ||     :|.|                                 
Mouse   117 ---------------------MN-----VTPA--------------------------------- 122

  Fly   196 AQINDNAVFEALPRYWEDQFHNDMKSLNILPPDVLTRVSEYVPQIVTFIQKIIDNGLAYA-ANNS 259
                      :|...:|::|..||.:|.:|||.|..||:|.:|||:.||:.||.:|.||: |..|
Mouse   123 ----------SLASLFEEEFKQDMAALKVLPPTVYLRVTENIPQIIAFIEGIIAHGHAYSTATGS 177

  Fly   260 VYFDVNGFDKREKHHYAKL---VPEAYGDTKSLQEGEGDLSIAEDRLSEKRSANDFALWKASKAG 321
            ||||::.  :.:|  |.||   ||.|      ..|..||        |:||.::|||||||:|..
Mouse   178 VYFDLHA--RGDK--YGKLVNTVPSA------TAEPAGD--------SDKRHSSDFALWKAAKPQ 224

  Fly   322 EPWWDSPWGKGRPGWHIECSAMASDIFGPTFDIHTGGVDLKFPHHDNELAQSEAAFNESEWVKYF 386
            |.:|.||||.||||||||||.|||::||...||||||:||.||||:||:||||......:|..||
Mouse   225 EVFWASPWGDGRPGWHIECSTMASEVFGSHLDIHTGGIDLAFPHHENEIAQSEVFHQCQQWGNYF 289

  Fly   387 LHTGHLTIAGC--KMSKSLKNFVTIQEA------------------------------------- 412
            ||:|||.:.|.  ||||||||::||::.                                     
Mouse   290 LHSGHLHVKGTEEKMSKSLKNYITIKDCRLSGRSLLDSCLHCCFDSIAEPSRGPKGKQDLPLRCD 354

  Fly   413 ------------------------------LKKHSATQLRLAFLLHSWKDTLDYSENTMEMATQY 447
                                          ||..|....||..|..:::..::||::|:..|...
Mouse   355 LHGGTTDPVHILHKGLLNRVTQLPFWSKDFLKTFSPDVFRLFCLRTNYRSAIEYSDSTLVEAKHL 419

  Fly   448 EKFLNEFFLNVKDLTRHVLSEEPRRQFDAWTEVEAALQKKFSNAQVQVHASLCDNIDTRSALDAI 512
            ...|..|   |:|...:|     :.|.......|..|.::.::.:..|.|:|.::.||..|::.|
Mouse   420 LLGLASF---VEDARAYV-----KGQLTCGPVEEDVLWERLTSTKKAVKAALANDFDTPRAVNTI 476

  Fly   513 RELVSVSNVYIRDNKTRLNSLLLRNVATYITDLLHVFGAISGPR-----GGI------GFPVSGG 566
            .:||..:|..:|                      .|....||||     |.|      .|...|.
Mouse   477 LDLVHHANRQLR----------------------AVSKEASGPRSPTVFGAIISYVEQFFETVGI 519

  Fly   567 SGA--QAAGADLETTVLP-YVQSLAEFRYLVREQA-------------KTLKAFDILKLCDDLRD 615
            |.|  |....|..|..|. .|..|..||..||:.|             :..:...:|:.||.||.
Mouse   520 SLANRQCVSGDSSTVTLRCVVDELVRFRLKVRQYALDTPGAAGEARKRQLQERQPLLEACDTLRQ 584

  Fly   616 NVLPNLGVRLEDKDIGKYAVKLVD 639
            :::.: |:.::|:.......:|:|
Mouse   585 DLVTH-GINVKDRGSAASTWELLD 607

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CysRSNP_611087.1 PTZ00399 2..737 CDD:240402 222/739 (30%)
CysRS_core 21..437 CDD:173899 163/489 (33%)
Cars2XP_011240384.1 CysS 38..606 CDD:223293 215/717 (30%)
CysRS_core 38..409 CDD:173899 163/489 (33%)
Anticodon_Ia_like 458..>494 CDD:299868 12/58 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D480663at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126755
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.