DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CysRS and cars2

Sequence 1:NP_611087.1 Gene:CysRS FlyBaseID:FBgn0027091 Length:741 Species:Drosophila melanogaster
Sequence 2:XP_682732.4 Gene:cars2 ZFINID:ZDB-GENE-030131-5564 Length:566 Species:Danio rerio

Alignment Length:655 Identity:218/656 (33%)
Similarity:311/656 (47%) Gaps:172/656 (26%)


  Fly     4 RGQPAWQAPEAVDRPKLKLFNSLTRQKEDFVPLDGNNVTWYSCGPTVYDASHMGHARSYISFDIL 68
            |.:..|..|...| ..:..:||||::||..:.......|||||||||||.:|:|||.||:.||||
Zfish    39 RTERGWVKPVGFD-TGVTAYNSLTKKKEPLILSQEKIATWYSCGPTVYDHAHLGHACSYVRFDIL 102

  Fly    69 RRILSDYFGYNIHYVMNITDIDDKIIRRARQNHLFDEYAAEAQKLPLDELLGQQKEVLQRFQDTC 133
            :||||..||.|:.:||.|||||||||:|:                                    
Zfish   103 QRILSRLFGINVIHVMVITDIDDKIIQRS------------------------------------ 131

  Fly   134 AKNTDPDKKIMLDKTLQRMNDAVEALTKAVGKGDEREISEKRLLYLNEAKDPISDWLDSLKGAQI 198
                                                         |.|...||:           
Zfish   132 ---------------------------------------------LEENISPIT----------- 140

  Fly   199 NDNAVFEALPRYWEDQFHNDMKSLNILPPDVLTRVSEYVPQIVTFIQKIIDNGLAY-AANNSVYF 262
                    |.|..|::|..||.:|.:|||.|..||:|.:|||:.||::||.||.|| .:..:|||
Zfish   141 --------LARMHEEEFKKDMLALRVLPPVVYMRVTENIPQIIAFIERIIGNGHAYVTSQGNVYF 197

  Fly   263 DVNGFDKREKHHYAKLVPEAYGDTKSLQEGEGDLSIAEDRLSEKRSANDFALWKASKAGEPWWDS 327
            :.    |...|.|.|||        :|....|     |..:.:|.::.|||||||||..||:|:|
Zfish   198 NT----KSISHRYGKLV--------NLGGNAG-----EQGVQDKENSRDFALWKASKPFEPYWES 245

  Fly   328 PWGKGRPGWHIECSAMASDIFGPTFDIHTGGVDLKFPHHDNELAQSEAAFNESEWVKYFLHTGHL 392
            |||:||||||||||.:||.:||...|||:||:||.||||:||:|||||.....:|..||||:|||
Zfish   246 PWGQGRPGWHIECSTIASSVFGHQLDIHSGGIDLAFPHHENEIAQSEAYHQCEQWGNYFLHSGHL 310

  Fly   393 TIAGC--KMSKSLKNFVTIQEALKKHSATQLRLAFLLHSWKDTLDYSENTMEMATQYEKFLNEFF 455
            .:.|.  ||||||||:|||::.|..::|.:.||..||..::..:|||:.:|..|......::.||
Zfish   311 HLKGSVEKMSKSLKNYVTIKDFLASYTANEFRLFCLLTKYRSAIDYSDASMNEAQSTLSTISAFF 375

  Fly   456 LNVKDLTRHVLSEEPRRQFDAWTEVEAALQKKFSNAQVQVHASLCDNIDTRSALDAIRELVSVSN 520
            .|.:...:..:..:|..:...|        ::.||.|..||..|.|:.||..|:|||..|:...|
Zfish   376 HNAQAYMQGHMQCQPVEEGFLW--------ERLSNTQTSVHKMLADDFDTPKAVDAIMSLIYHGN 432

  Fly   521 VYIRDNKTRLNS----LLLRNVATYITDLLHVFGAISGPRGGIGFPVSGGSGAQAAGADLETTVL 581
            ..::. .|:::.    .:...:.:|:.:::.|||.          .:|..:..|.:...|...  
Zfish   433 CQLQP-ATKVDGPRSPAVFGAIMSYVMEIMSVFGV----------DLSDKTEVQVSSGVLNNV-- 484

  Fly   582 PYVQSLAEFRYLVREQAKTLK-----------------------AFDILKLCDDLRDNVLPNLGV 623
              |:.|..||..||:.|.:::                       ...:||.||.||:|:.| |||
Zfish   485 --VEELVHFRSEVRKFALSVEDQAPQESQTGNKNQKRHHQPDRLHLSLLKACDALRNNLAP-LGV 546

  Fly   624 RLEDK 628
            .::|:
Zfish   547 HIKDR 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CysRSNP_611087.1 PTZ00399 2..737 CDD:240402 218/656 (33%)
CysRS_core 21..437 CDD:173899 164/419 (39%)
cars2XP_682732.4 CysS 57..559 CDD:223293 214/637 (34%)
CysRS_core 57..357 CDD:173899 164/417 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D480663at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126755
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.