DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CysRS and cars

Sequence 1:NP_611087.1 Gene:CysRS FlyBaseID:FBgn0027091 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_001011365.1 Gene:cars XenbaseID:XB-GENE-5825933 Length:747 Species:Xenopus tropicalis

Alignment Length:740 Identity:435/741 (59%)
Similarity:531/741 (72%) Gaps:19/741 (3%)


  Fly     3 KRGQPAWQAPEAVDRPKLKLFNSLTRQKEDFVPLDGNNVTWYSCGPTVYDASHMGHARSYISFDI 67
            :|.||.|.||....:|.|:|:|||||.||.|||.|||.||||.||||||||||||||||||||||
 Frog    11 RRTQPPWSAPNTQAQPGLRLYNSLTRSKELFVPQDGNKVTWYCCGPTVYDASHMGHARSYISFDI 75

  Fly    68 LRRILSDYFGYNIHYVMNITDIDDKIIRRARQNHLFDEYAAEAQKLPLDELLGQQKEVLQRFQDT 132
            |||:|.|||.|::.|.|||||||||||:||||.|||.:| .|....|.| ||......|..|...
 Frog    76 LRRVLRDYFKYDVFYCMNITDIDDKIIKRARQRHLFQQY-RERNPRPSD-LLQDVSAALTPFLQR 138

  Fly   133 CAKNTDPDKKIMLDKTLQRMNDAVEALTKAVGKGDEREISEKRLLYLNEAK-DPISDWLDSLKGA 196
            .::..||||:.||::....::.|:..|..||......|..|:....|.||. |.:|||||...||
 Frog   139 ISEANDPDKRQMLERIHGSVSAALLPLQDAVSSNARAEELERLSQELMEAAVDLLSDWLDEKHGA 203

  Fly   197 QINDNAVFEALPRYWEDQFHNDMKSLNILPPDVLTRVSEYVPQIVTFIQKIIDNGLAYAANNSVY 261
            ||.||::|..||::||.::|.||::||:||||||||||||||:||.|:|:|:|||..|.:|.|||
 Frog   204 QITDNSIFSQLPKHWESEYHRDMEALNVLPPDVLTRVSEYVPEIVAFVQRIVDNGYGYVSNGSVY 268

  Fly   262 FDVNGFDKREKHHYAKLVPEAYGDTKSLQEGEGDLSIAEDRLSEKRSANDFALWKASKAGEPWWD 326
            |....|...|||:||||||||.||.|:||||||||||:.||||||:|.||||||||||.|||.|:
 Frog   269 FSTAKFHASEKHYYAKLVPEAVGDQKALQEGEGDLSISADRLSEKQSPNDFALWKASKPGEPSWE 333

  Fly   327 SPWGKGRPGWHIECSAMASDIFGPTFDIHTGGVDLKFPHHDNELAQSEAAFNESEWVKYFLHTGH 391
            ||||||||||||||||||..|.|.:.|||.||.||:|||||||||||||.|:...||:|||||||
 Frog   334 SPWGKGRPGWHIECSAMAGSILGESMDIHGGGFDLRFPHHDNELAQSEAYFDNDHWVRYFLHTGH 398

  Fly   392 LTIAGCKMSKSLKNFVTIQEALKKHSATQLRLAFLLHSWKDTLDYSENTMEMATQYEKFLNEFFL 456
            |||||||||||||||:||::||:|::|.|||||||:|:||||||||.||||.|.|||||:|||||
 Frog   399 LTIAGCKMSKSLKNFITIKDALQKNTARQLRLAFLMHAWKDTLDYSSNTMESAVQYEKFMNEFFL 463

  Fly   457 NVKDLTRHVLSEEPRRQFDAWTEVEAALQKKFSNAQVQVHASLCDNIDTRSALDAIRELVSVSNV 521
            |||||.|  ...:...||..|...|..|...|.:.:..||.:||||||||:.::.:|.|||..|.
 Frog   464 NVKDLLR--APTDVTGQFVKWEVPELELNSCFYSKKAAVHEALCDNIDTRTVMEEMRSLVSQCNS 526

  Fly   522 YIRDNKTRL---NSLLLRNVATYITDLLHVFGAISGPRGGIGFPVSGGSGAQAAGADLETTVLPY 583
            ||...|...   |.||||:|::|:|.:|.|||||.|.. .||||:.|...:.    :||:||:||
 Frog   527 YIASRKAAKQPPNRLLLRSVSSYLTAMLKVFGAIEGEE-VIGFPIGGSDNSM----NLESTVMPY 586

  Fly   584 VQSLAEFRYLVREQAKTLKAFDILKLCDDLRDNVLPNLGVRLEDKDIGKYAVKLVDRDSLLRERE 648
            :|.|::||..||:.|:..|..::|:|.|.|||:|||.|||||||.:.....||||||::||:|:|
 Frog   587 LQVLSQFREGVRQIARQHKVTEVLQLSDLLRDDVLPELGVRLEDHEGLPTVVKLVDRETLLKEKE 651

  Fly   649 AKLAAEAEKAAEKE---RKKQAAAEAAAAKEAQRRVNPKEMFLAETEKYSAFDENGLPTHDKEGK 710
            .|..||.||..:||   ||||   :..|||..:.:|:|.:||..||:|||.|||:|.||||.|||
 Frog   652 EKRKAEEEKQRKKEEAARKKQ---QQEAAKLEKMKVSPSQMFQLETDKYSQFDESGFPTHDTEGK 713

  Fly   711 EVSKGQIKKLQKLQQQQEQRYNEYL 735
            |:||||.|||:||.:.||:.:.|||
 Frog   714 ELSKGQSKKLRKLYEAQEKLHKEYL 738

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CysRSNP_611087.1 PTZ00399 2..737 CDD:240402 435/741 (59%)
CysRS_core 21..437 CDD:173899 272/417 (65%)
carsNP_001011365.1 PTZ00399 11..738 CDD:240402 434/739 (59%)
'HIGH' region 56..66 10/10 (100%)
'KMSKS' region 405..409 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C136021173
eggNOG 1 0.900 E1_COG0215
Hieranoid 1 1.000
Homologene 1 1.000 H1328
Inparanoid 1 1.050 838 1.000 Inparanoid score I403
OMA 1 1.010
OrthoDB 1 1.010 D480663at33208
OrthoFinder 1 1.000 FOG0004329
OrthoInspector 1 1.000 T601117
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1431
TreeFam 1 0.960
1110.890

Return to query results.
Submit another query.