DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CysRS and cars2

Sequence 1:NP_611087.1 Gene:CysRS FlyBaseID:FBgn0027091 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_001004887.2 Gene:cars2 XenbaseID:XB-GENE-976543 Length:609 Species:Xenopus tropicalis

Alignment Length:224 Identity:51/225 (23%)
Similarity:85/225 (38%) Gaps:69/225 (31%)


  Fly   104 DEYAAEAQKLPLDELLGQQKEVLQRFQDTCAKNTDPDKKIMLDKTLQRMNDAVEALTK--AVGKG 166
            ||..||..| |:.|.. :...|.:::.:        ::::.|.:.|..::...:.|:|  .|...
 Frog   321 DEVPAELSK-PITEFT-EDPHVCEKYAE--------NQEVFLGRYLHAVSRKHQELSKEFLVQSA 375

  Fly   167 DERE---------------ISEKRLLYLNEAKDPISDWLDSLKGAQINDNAVFEALPRYWEDQFH 216
            .|.|               ..:...|:|||||:         :.|.:..|.  :||..:.|..|.
 Frog   376 KEYETLLNKCCKTDNPPDCYKDAANLFLNEAKE---------RFAYLKQNC--DALQEHGEYLFE 429

  Fly   217 NDMKSLNILPPDVLTRVSEYVPQIVTFIQKIIDNGLAYAANNSVYFDVNGFDKREKHHYAKLVPE 281
            |          |.|.|.::.:|.:.:       .||...|:...  |:.      :|..|  :||
 Frog   430 N----------DALIRYAKKMPTVSS-------KGLIGLAHQMA--DIG------EHCCA--LPE 467

  Fly   282 AYGDTKSLQEGEGDLSIAEDRLSEKRSAN 310
                .:.|...||||||...:|.||:..|
 Frog   468 ----NQRLPCAEGDLSILFGKLCEKQKKN 492

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CysRSNP_611087.1 PTZ00399 2..737 CDD:240402 51/225 (23%)
CysRS_core 21..437 CDD:173899 51/225 (23%)
cars2NP_001004887.2 ALBUMIN 28..205 CDD:214517
ALBUMIN 215..397 CDD:214517 15/86 (17%)
ALBUMIN 414..600 CDD:237982 29/113 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.