DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CysRS and cars

Sequence 1:NP_611087.1 Gene:CysRS FlyBaseID:FBgn0027091 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_001112372.1 Gene:cars ZFINID:ZDB-GENE-030328-29 Length:824 Species:Danio rerio

Alignment Length:755 Identity:443/756 (59%)
Similarity:544/756 (72%) Gaps:41/756 (5%)


  Fly     3 KRGQPAWQAPEAVDRPKLKLFNSLTRQKEDFVPLDGNNVTWYSCGPTVYDASHMGHARSYISFDI 67
            ||.||.|..||..|..||:|:|||||.||.|||..||.|.||.||||||||||||||||||||||
Zfish    90 KRVQPPWSPPEGTDISKLRLYNSLTRTKEVFVPQKGNRVLWYCCGPTVYDASHMGHARSYISFDI 154

  Fly    68 LRRILSDYFGYNIHYVMNITDIDDKIIRRARQNHLFDEYAAEAQKLPLDELLGQQKEVLQ----- 127
            |||||.:||.|::.|.|||||||||||:|||||:|.::|   .:|.|      ...::||     
Zfish   155 LRRILKNYFKYDVFYCMNITDIDDKIIKRARQNYLLEQY---REKKP------SAAQILQDVLTA 210

  Fly   128 --RFQDTCAKNTDPDKKIMLDKTLQRMNDAVEA----LTKAV-GKGDEREISEKRLLYLNEAKDP 185
              .|:...|:.||||||.|    |:|::.||:|    |..|| .|..:..|.::..:.|.||||.
Zfish   211 RTPFKAKLAETTDPDKKQM----LERLDSAVDAALGPLQVAVQSKAAQDSIQKQAQVLLEEAKDL 271

  Fly   186 ISDWLDSLKGAQINDNAVFEALPRYWEDQFHNDMKSLNILPPDVLTRVSEYVPQIVTFIQKIIDN 250
            :||||||..|:|:.:|::|..||:|||.::|.||::||:||||||||||||||:||.|::||:||
Zfish   272 LSDWLDSQFGSQVTENSIFSLLPKYWEGEYHKDMEALNVLPPDVLTRVSEYVPEIVEFVKKIVDN 336

  Fly   251 GLAYAANNSVYFDVNGFDKREKHHYAKLVPEAYGDTKSLQEGEGDLSIAEDRLSEKRSANDFALW 315
            |..|.:|.|||||...||....|.||||||||.||.|:||||||||||:.||||||||.||||||
Zfish   337 GYGYESNGSVYFDTAKFDSCPAHSYAKLVPEAVGDQKALQEGEGDLSISADRLSEKRSQNDFALW 401

  Fly   316 KASKAGEPWWDSPWGKGRPGWHIECSAMASDIFGPTFDIHTGGVDLKFPHHDNELAQSEAAFNES 380
            ||||.|||.||||||.|||||||||||||..|.|.:.|||.||.||:|||||||||||||.|...
Zfish   402 KASKPGEPSWDSPWGMGRPGWHIECSAMAGSILGESMDIHGGGFDLRFPHHDNELAQSEAYFEND 466

  Fly   381 EWVKYFLHTGHLTIAGCKMSKSLKNFVTIQEALKKHSATQLRLAFLLHSWKDTLDYSENTMEMAT 445
            .||:||||||||||||||||||||||:||::||.||:|.|||||||:||||||||||.||||.|.
Zfish   467 YWVRYFLHTGHLTIAGCKMSKSLKNFITIKDALAKHTARQLRLAFLMHSWKDTLDYSNNTMESAI 531

  Fly   446 QYEKFLNEFFLNVKDLTRHVLSEEPRRQFDAWTEVEAALQKKFSNAQVQVHASLCDNIDTRSALD 510
            |||:|:|||||||||:.|.  ..:...|::.|...|..|.|.|.:.:..||.:|||||||||||:
Zfish   532 QYERFINEFFLNVKDILRS--PTDITGQYEKWEAEEIELNKCFYDKKTSVHGALCDNIDTRSALE 594

  Fly   511 AIRELVSVSNVYI---RDNKTRLNSLLLRNVATYITDLLHVFGAISGPRGGIGFPVSGGSGAQAA 572
            .:|.||..||.|:   |..|...|.:||:::|.|:||:|..||||.| ...||||| ||:|   .
Zfish   595 EMRALVGQSNTYMAARRSAKLPPNRMLLQSIALYLTDMLKTFGAIEG-TDPIGFPV-GGNG---Q 654

  Fly   573 GADLETTVLPYVQSLAEFRYLVREQAKTLKAFDILKLCDDLRDNVLPNLGVRLEDKDIGKYAVKL 637
            .||||:||:||:..|::||..||:.|:..|..::|:|||.|||:.||.|||||||:|....:|||
Zfish   655 SADLESTVMPYLSVLSDFREDVRKIAREKKVTELLQLCDQLRDDTLPELGVRLEDRDGLPTSVKL 719

  Fly   638 VDRDSLLREREAKLAAEAEKAAEKE---RKKQAAAEAAAAKEAQRRVNPKEMFLAETEKYSAFDE 699
            ||:::||:|:|.|...:.:|..:||   ||||   |...||.|:.::.|.|||.:||:|||:|||
Zfish   720 VDKETLLKEKEEKKKLKDDKRKKKEEAARKKQ---EQEMAKLAKMKLKPSEMFRSETDKYSSFDE 781

  Fly   700 NGLPTHDKEGKEVSKGQIKKLQKLQQQQEQRYNEYLASIE 739
            .|.||||.||||:|||..|||:||.:.||:.:||||.|.:
Zfish   782 TGFPTHDAEGKELSKGLTKKLRKLYETQEKLHNEYLQSTQ 821

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CysRSNP_611087.1 PTZ00399 2..737 CDD:240402 442/752 (59%)
CysRS_core 21..437 CDD:173899 276/428 (64%)
carsNP_001112372.1 GST_C_CysRS_N 2..74 CDD:198343
PTZ00399 85..822 CDD:240402 443/756 (59%)
CysRS_core 108..523 CDD:173899 276/428 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C136025801
eggNOG 1 0.900 E1_COG0215
Hieranoid 1 1.000
Homologene 1 1.000 H1328
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D480663at33208
OrthoFinder 1 1.000 FOG0004329
OrthoInspector 1 1.000 T1052473
orthoMCL 1 0.900 OOG5_126755
Panther 1 1.100 LDO PTHR10890
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1431
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.750

Return to query results.
Submit another query.