DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CysRS and CysRS-m

Sequence 1:NP_611087.1 Gene:CysRS FlyBaseID:FBgn0027091 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_001286405.1 Gene:CysRS-m FlyBaseID:FBgn0033900 Length:558 Species:Drosophila melanogaster

Alignment Length:671 Identity:209/672 (31%)
Similarity:316/672 (47%) Gaps:162/672 (24%)


  Fly     3 KRGQP-AWQAPEAVDRPKLKLFNSLTRQKEDFVPLDGNNVTWYSCGPTVYDASHMGHARSYISFD 66
            |:..| .|:.|.. ....:.::|...|||...:..:...||||:|||||||::|:|||.:|:..|
  Fly    31 KQDSPFKWRKPIG-QHTGINIYNHGLRQKVPLILRNPQMVTWYTCGPTVYDSAHLGHASTYVKVD 94

  Fly    67 ILRRILSDYFGYNIHYVMNITDIDDKIIRRARQNHLFDEYAAEAQKLPLDELLGQQKEVLQRFQD 131
            ||:|||.|||..|:...|||||:|||||:||                   :|.|           
  Fly    95 ILQRILRDYFKINLVTAMNITDVDDKIIKRA-------------------QLAG----------- 129

  Fly   132 TCAKNTDPDKKIMLDKTLQRMNDAVEALTKAVGKGDEREISEKRLLYLNEAKDPISDWLDSLKGA 196
                                                                   .||       
  Fly   130 -------------------------------------------------------LDW------- 132

  Fly   197 QINDNAVFEALPRYWEDQFHNDMKSLNILPPDVLTRVSEYVPQIVTFIQKIIDNGLAYAA-NNSV 260
                    :.:.|.:|.:|..||..||:..|||.:.|:..:|.|:.|||::||...||.. :|||
  Fly   133 --------QKMARAYEAEFRQDMLRLNVQAPDVRSHVTTTMPVIIQFIQQLIDGKQAYVTPDNSV 189

  Fly   261 YFDVNGFDKREKHHYAKLVPEAYGDTKSLQEGEGDLSIAEDRLSE-KRSANDFALWKASKAG-EP 323
            ||||:     :..:|.||               .:|.::||:|.. ||:..|||||||.|:| ||
  Fly   190 YFDVS-----KSKNYGKL---------------QNLGLSEDKLDPIKRNTADFALWKARKSGSEP 234

  Fly   324 WWDSPW-GKGRPGWHIECSAMASDIFGPTFDIHTGGVDLKFPHHDNELAQSEAAFNESEWVKYFL 387
            .|.:|| |:|||||||||||:|...||...|||.||:||:||||:||.||..|.:...:||.|::
  Fly   235 TWAAPWGGEGRPGWHIECSAIAGLFFGRQLDIHAGGLDLRFPHHENEEAQCCARYKTDQWVNYWV 299

  Fly   388 HTGHLTIAGC--KMSKSLKNFVTIQEALKKHSATQLRLAFLLHSWKDTLDYSENTMEMATQ-YEK 449
            |||.|.:.|.  ||||||.|.:::.|.|||::|.:.|:|.||.::::.:.||:..|..|.| .::
  Fly   300 HTGQLHMVGDREKMSKSLGNTISVSELLKKYTADEFRMACLLSNYRNAMPYSDQLMVTARQTLQR 364

  Fly   450 FLNEFFLNVKDLTRHVLSEEPRRQFDAWTEVEAALQKKFSNAQVQVHASLCDNIDTRSALDA-IR 513
            |.|    ...||:.:....:|....|     |.||:.:.::...:....|.|:.||..|:.. |.
  Fly   365 FRN----FQADLSAYTQFLKPVHLLD-----EGALKAQLTHTVTEFDNCLRDDFDTARAISVLID 420

  Fly   514 ELVSVSNVYIRDNKTRLNSLLLRNVATYITDLLHVFGAISGPRGGIGFPVS---GGSGAQAAGAD 575
            ::.|:|...   |:.::::   :....|..|||...|.... |..:.|.:|   .....|...:.
  Fly   421 QMSSISRCI---NEQQVDA---QEEPAYCIDLLLAAGNFIN-RAIVTFGLSELQDKESLQEKVSF 478

  Fly   576 LETTVLP--YVQSLAEFRYLVREQAKT--LKAFDILKLCDDLRDNVLPNLGVRLEDKDIGK---Y 633
            .:.::.|  .|..:...|..:||:|.:  :|...:|..||:|| ::|...|:::.|...|.   :
  Fly   479 TDHSIDPNLLVNDVINVRGRMRERATSGNVKNPQLLAACDELR-SLLQQHGIQVRDHKQGSSWVF 542

  Fly   634 AVKLVDRDSLLREREAKLAAE 654
            ||....:|.     ::|.:||
  Fly   543 AVSCEKQDD-----KSKSSAE 558

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CysRSNP_611087.1 PTZ00399 2..737 CDD:240402 209/672 (31%)
CysRS_core 21..437 CDD:173899 152/422 (36%)
CysRS-mNP_001286405.1 CysRS_core 49..351 CDD:173899 152/422 (36%)
CysS 50..540 CDD:223293 199/627 (32%)
DALR_2 400..454 CDD:214848 14/60 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C136813921
eggNOG 1 0.900 E1_COG0215
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D480663at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126755
Panther 1 1.100 P PTHR10890
RoundUp 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.