DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CysRS and Cars2

Sequence 1:NP_611087.1 Gene:CysRS FlyBaseID:FBgn0027091 Length:741 Species:Drosophila melanogaster
Sequence 2:XP_006253522.2 Gene:Cars2 RGDID:1311612 Length:553 Species:Rattus norvegicus

Alignment Length:665 Identity:216/666 (32%)
Similarity:308/666 (46%) Gaps:192/666 (29%)


  Fly     1 MSKRGQPAWQAPEAVDRPKLKLFNSLTRQKEDFVPLDGNNVTWYSCGPTVYDASHMGHARSYISF 65
            :.:||: |||.|:..| ..:::.||||.:||..:....:.|:||||||||||.:|:|||.||:.|
  Rat    20 LGRRGR-AWQRPQGQD-TGVQVHNSLTGKKEPLIVGRSDAVSWYSCGPTVYDHAHLGHACSYVRF 82

  Fly    66 DILRRILSDYFGYNIHYVMNITDIDDKIIRRARQNHLFDEYAAEAQKLPLDELLGQQKEVLQRFQ 130
            ||:||||:..||.|:...|:|||:|||||:||.:                               
  Rat    83 DIIRRILTSVFGCNVVMAMSITDVDDKIIKRANE------------------------------- 116

  Fly   131 DTCAKNTDPDKKIMLDKTLQRMNDAVEALTKAVGKGDEREISEKRLLYLNEAKDPISDWLDSLKG 195
                .|..|                                                        
  Rat   117 ----MNVSP-------------------------------------------------------- 121

  Fly   196 AQINDNAVFEALPRYWEDQFHNDMKSLNILPPDVLTRVSEYVPQIVTFIQKIIDNGLAYA-ANNS 259
                     .:|...:|::|..||.:|.:|||.|..||:|.:|||::|||.||.:|.||| |..|
  Rat   122 ---------ASLASLFEEEFKQDMAALKVLPPTVYLRVTENIPQIISFIQGIIAHGHAYATATGS 177

  Fly   260 VYFDVNGFDKREKHHYAKL---VPEAYGDTKSLQEGEGDLSIAEDRLSEKRSANDFALWKASKAG 321
            ||||:..  :.:|  |.||   ||.|..:.            |.|  |:||.::||||||.:|..
  Rat   178 VYFDLRA--RGDK--YGKLVNTVPSATAEP------------AVD--SDKRHSSDFALWKGAKPQ 224

  Fly   322 EPWWDSPWGKGRPGWHIECSAMASDIFGPTFDIHTGGVDLKFPHHDNELAQSEAAFNESEWVKYF 386
            |.:|.||||.||||||||||||||::||...||||||:||.||||:||:||||......:|..||
  Rat   225 EVFWASPWGDGRPGWHIECSAMASEVFGSQLDIHTGGIDLAFPHHENEIAQSEVFHQCQQWGNYF 289

  Fly   387 LHTGHLTIAGC--KMSKSLKNFVTIQEALKKHSATQLRLAFLLHSWKDTLDYSENTMEMATQYEK 449
            ||:|||.:.|.  ||||||||::||::.|:..|....||..|..:::..:|||::|:|.|.....
  Rat   290 LHSGHLHVKGKEEKMSKSLKNYITIKDFLQTFSPDVFRLFCLRTNYRSAIDYSDSTLEEARHLLL 354

  Fly   450 FLNEFFLNVKDLTRHVLSEEPRRQFDAWTEVEAALQKKFSNAQVQVHASLCDNIDTRSALDAIRE 514
            .|..|   |:|...:|     :.|.......|..|.::.::.:..|.|:|.::.||..|:::|.:
  Rat   355 GLASF---VEDARAYV-----KGQLICGPVGEDVLWERLASTKKAVKAALANDFDTPRAVNSILD 411

  Fly   515 LVSVSNVYIRDNKTRLNSLLLRNVATYITDLLHVFGAISGPRGGIGFPVSGG------------- 566
            ||..:|..:|                          |:|...||...|...|             
  Rat   412 LVHHANRQLR--------------------------AVSKEAGGPRSPTVFGAIVAYVEQFFETV 450

  Fly   567 ----SGAQAAGADLETTVLP-YVQSLAEFRYLVREQA-------------KTLKAFDILKLCDDL 613
                :..|....|..|..|. .|..|..||..||:.|             :..:...:|:.||.|
  Rat   451 GISLAKRQCVSGDSSTVALHCVVDELVRFRLKVRQYALATPGATGEARKQQLQERQPLLEACDAL 515

  Fly   614 RDNVLPN-LGVRLED 627
            |.:::.: :.|::.|
  Rat   516 RQDLMTHGINVKVSD 530

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CysRSNP_611087.1 PTZ00399 2..737 CDD:240402 216/665 (32%)
CysRS_core 21..437 CDD:173899 162/422 (38%)
Cars2XP_006253522.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D480663at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126755
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.