DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CysRS and Cars

Sequence 1:NP_611087.1 Gene:CysRS FlyBaseID:FBgn0027091 Length:741 Species:Drosophila melanogaster
Sequence 2:XP_006230775.1 Gene:Cars RGDID:1310747 Length:831 Species:Rattus norvegicus

Alignment Length:746 Identity:440/747 (59%)
Similarity:541/747 (72%) Gaps:19/747 (3%)


  Fly     3 KRGQPAWQAPEAVDRPKLKLFNSLTRQKEDFVPLDGNNVTWYSCGPTVYDASHMGHARSYISFDI 67
            :|.||.|..|...:..:|:|:|||||.|:.|:|.||..||||.||||||||||||||||||||||
  Rat    95 RRVQPQWSPPAGTEPCRLRLYNSLTRNKDVFIPQDGKKVTWYCCGPTVYDASHMGHARSYISFDI 159

  Fly    68 LRRILSDYFGYNIHYVMNITDIDDKIIRRARQNHLFDEYAAEAQKLPLDELLGQQKEVLQRFQDT 132
            |||:|.|||.|::.|.|||||||||||||||||:||::|  ..||....:||....:.::.|...
  Rat   160 LRRVLRDYFQYDVFYCMNITDIDDKIIRRARQNYLFEQY--REQKPSAAQLLKDVGDAMKPFSVK 222

  Fly   133 CAKNTDPDKKIMLDKTLQRMNDAVEALTKAVGKGDEREISEKRL-LYLNEAKDPISDWLDSLKGA 196
            .::.|||||:.||::....:..|.|.|.:||......|..:.|: :.|.||||.:||||||..|:
  Rat   223 LSETTDPDKRQMLERIQNSVKLATEPLEQAVHSNPSGEEVDSRVQVLLEEAKDLLSDWLDSTGGS 287

  Fly   197 QINDNAVFEALPRYWEDQFHNDMKSLNILPPDVLTRVSEYVPQIVTFIQKIIDNGLAYAANNSVY 261
            ::.||::|..||::||::||.||::||:||||||||||||||:||.|:|||:|||..||:|.|||
  Rat   288 EVTDNSIFSKLPKFWEEEFHKDMEALNVLPPDVLTRVSEYVPEIVNFVQKIVDNGYGYASNGSVY 352

  Fly   262 FDVNGFDKREKHHYAKLVPEAYGDTKSLQEGEGDLSIAEDRLSEKRSANDFALWKASKAGEPWWD 326
            ||...|...|||.|.||||||.||.|:||||||||||:.||||||||.||||||||||.|||.|.
  Rat   353 FDTAKFAASEKHSYGKLVPEAVGDQKALQEGEGDLSISADRLSEKRSPNDFALWKASKPGEPSWP 417

  Fly   327 SPWGKGRPGWHIECSAMASDIFGPTFDIHTGGVDLKFPHHDNELAQSEAAFNESEWVKYFLHTGH 391
            .|||||||||||||||||..:.|.:.|||.||.||:|||||||||||||.|....||:|||||||
  Rat   418 CPWGKGRPGWHIECSAMAGSLLGASMDIHGGGFDLRFPHHDNELAQSEAYFENDCWVRYFLHTGH 482

  Fly   392 LTIAGCKMSKSLKNFVTIQEALKKHSATQLRLAFLLHSWKDTLDYSENTMEMATQYEKFLNEFFL 456
            |||||||||||||||:||::|||||||.|||||||:||||||||||.||||.|.|||||:|||||
  Rat   483 LTIAGCKMSKSLKNFITIKDALKKHSARQLRLAFLMHSWKDTLDYSSNTMESALQYEKFMNEFFL 547

  Fly   457 NVKDLTRHVLSEEPRRQFDAWTEVEAALQKKFSNAQVQVHASLCDNIDTRSALDAIRELVSVSNV 521
            ||||:.|..:  :...||:.|...|..|.|.|.:.:..||.:||||||||:.::.:|.|||..|:
  Rat   548 NVKDILRAPV--DITGQFEKWEAEEVELNKNFYDKKTAVHEALCDNIDTRTVMEEMRALVSQCNL 610

  Fly   522 YIRDNKT---RLNSLLLRNVATYITDLLHVFGAISGPRGGIGFPVSGGSGAQAAGADLETTVLPY 583
            |:...|.   |.|..||.|:|.|:|.:|.:||||. ....:|||| ||.|   ...:||:||:||
  Rat   611 YMAARKAARRRPNRALLENIAMYLTHMLKIFGAIE-EENPLGFPV-GGPG---TNLNLESTVMPY 670

  Fly   584 VQSLAEFRYLVREQAKTLKAFDILKLCDDLRDNVLPNLGVRLEDKDIGKYAVKLVDRDSLLRERE 648
            :|.|:|||..||:.|:..|..::|:|.|.|||::||.||||.||.:.....|||||||:||:|:|
  Rat   671 LQVLSEFREGVRKIAREKKVLEVLQLSDALRDDILPELGVRFEDHEGLPTVVKLVDRDTLLKEKE 735

  Fly   649 AKLAAEAEKAAEKE---RKKQAAAEAAAAKEAQRRVNPKEMFLAETEKYSAFDENGLPTHDKEGK 710
            .|..||.||..:||   ||||   |..|||.|:.:..|.|||.:||:|||.||||||||||.|||
  Rat   736 EKKRAEEEKRRKKEEAARKKQ---EQEAAKLAKMKTPPSEMFRSETDKYSKFDENGLPTHDTEGK 797

  Fly   711 EVSKGQIKKLQKLQQQQEQRYNEYLASIEKA 741
            |:||||.|||:||.:.||:.|.|||..::.:
  Rat   798 ELSKGQTKKLKKLFEAQEKVYKEYLQQLQNS 828

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CysRSNP_611087.1 PTZ00399 2..737 CDD:240402 440/741 (59%)
CysRS_core 21..437 CDD:173899 275/417 (66%)
CarsXP_006230775.1 GST_C_CysRS_N 4..76 CDD:198343
PTZ00399 91..828 CDD:240402 440/745 (59%)
CysRS_core 113..528 CDD:173899 275/417 (66%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C136023556
eggNOG 1 0.900 E1_COG0215
Hieranoid 1 1.000
Homologene 1 1.000 H1328
Inparanoid 1 1.050 864 1.000 Inparanoid score I391
OMA 1 1.010
OrthoDB 1 1.010 D480663at33208
OrthoFinder 1 1.000 FOG0004329
OrthoInspector 1 1.000 T1086746
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10890
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.