DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CysRS and Cars

Sequence 1:NP_611087.1 Gene:CysRS FlyBaseID:FBgn0027091 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_038770.3 Gene:Cars MGIID:1351477 Length:831 Species:Mus musculus

Alignment Length:744 Identity:441/745 (59%)
Similarity:540/745 (72%) Gaps:19/745 (3%)


  Fly     3 KRGQPAWQAPEAVDRPKLKLFNSLTRQKEDFVPLDGNNVTWYSCGPTVYDASHMGHARSYISFDI 67
            :|.||.|..|...:..:|:|:|||||.|:.|:|.||..||||.||||||||||||||||||||||
Mouse    95 RRVQPQWSPPAGTEPCRLRLYNSLTRNKDVFIPQDGKKVTWYCCGPTVYDASHMGHARSYISFDI 159

  Fly    68 LRRILSDYFGYNIHYVMNITDIDDKIIRRARQNHLFDEYAAEAQKLPLDELLGQQKEVLQRFQDT 132
            |||:|.|||.|::.|.|||||||||||||||||:||::|  ..||.|..:||...::.::.|...
Mouse   160 LRRVLRDYFQYDVFYCMNITDIDDKIIRRARQNYLFEQY--REQKPPATQLLKDVRDAMKPFSVK 222

  Fly   133 CAKNTDPDKKIMLDKTLQRMNDAVEALTKAVGKG-DEREISEKRLLYLNEAKDPISDWLDSLKGA 196
            .::.|||||:.||::....:..|.|.|.:||... ...|:..|..:.|.||||.:||||||..|:
Mouse   223 LSETTDPDKRQMLERIQNSVKLATEPLEQAVRSSLSGEEVDSKVQVLLEEAKDLLSDWLDSTGGS 287

  Fly   197 QINDNAVFEALPRYWEDQFHNDMKSLNILPPDVLTRVSEYVPQIVTFIQKIIDNGLAYAANNSVY 261
            ::.||::|..||::||::||.||::||:||||||||||||||:||.|:|||:|||..||:|.|||
Mouse   288 EVTDNSIFSKLPKFWEEEFHKDMEALNVLPPDVLTRVSEYVPEIVNFVQKIVDNGYGYASNGSVY 352

  Fly   262 FDVNGFDKREKHHYAKLVPEAYGDTKSLQEGEGDLSIAEDRLSEKRSANDFALWKASKAGEPWWD 326
            ||...|...|||.|.||||||.||.|:||||||||||:.||||||||.||||||||||.|||.|.
Mouse   353 FDTAKFAASEKHSYGKLVPEAVGDQKALQEGEGDLSISADRLSEKRSPNDFALWKASKPGEPSWP 417

  Fly   327 SPWGKGRPGWHIECSAMASDIFGPTFDIHTGGVDLKFPHHDNELAQSEAAFNESEWVKYFLHTGH 391
            .|||||||||||||||||..:.|.:.|||.||.||:|||||||||||||.|....||:|||||||
Mouse   418 CPWGKGRPGWHIECSAMAGTLLGASMDIHGGGFDLRFPHHDNELAQSEAYFENDCWVRYFLHTGH 482

  Fly   392 LTIAGCKMSKSLKNFVTIQEALKKHSATQLRLAFLLHSWKDTLDYSENTMEMATQYEKFLNEFFL 456
            |||||||||||||||:||::|||||||.|||||||:||||||||||.||||.|.|||||:|||||
Mouse   483 LTIAGCKMSKSLKNFITIKDALKKHSARQLRLAFLMHSWKDTLDYSSNTMESALQYEKFMNEFFL 547

  Fly   457 NVKDLTRHVLSEEPRRQFDAWTEVEAALQKKFSNAQVQVHASLCDNIDTRSALDAIRELVSVSNV 521
            ||||:.|..:  :...||:.|...|..|.|.|...:..||.:||||||||:.::.:|.|||..|:
Mouse   548 NVKDILRAPV--DITGQFEKWEAEEVELNKNFYGKKTAVHEALCDNIDTRTVMEEMRALVSQCNL 610

  Fly   522 YIRDNKT---RLNSLLLRNVATYITDLLHVFGAISGPRGGIGFPVSGGSGAQAAGADLETTVLPY 583
            |:...|.   |.|..||.|:|.|:|.:|.:||||. ....:|||| ||.|   ...:||:||:||
Mouse   611 YMAARKAERRRPNRALLENIAMYLTHMLKIFGAIE-EESPLGFPV-GGPG---TNLNLESTVMPY 670

  Fly   584 VQSLAEFRYLVREQAKTLKAFDILKLCDDLRDNVLPNLGVRLEDKDIGKYAVKLVDRDSLLRERE 648
            :|.|:|||..||:.|:..|..::|:|.|.|||::||.||||.||.:.....|||||||:||:|:|
Mouse   671 LQVLSEFREGVRKIAREKKVLEVLQLSDALRDDILPELGVRFEDHEGLPTVVKLVDRDTLLKEKE 735

  Fly   649 AKLAAEAEKAAEKE---RKKQAAAEAAAAKEAQRRVNPKEMFLAETEKYSAFDENGLPTHDKEGK 710
            .|..||.||..:||   ||||   |..|||.|:.::.|.||||:|..|||.||||||||||.|||
Mouse   736 GKKRAEEEKRRKKEEAARKKQ---EQEAAKLAKMKIPPSEMFLSEVNKYSKFDENGLPTHDTEGK 797

  Fly   711 EVSKGQIKKLQKLQQQQEQRYNEYLASIE 739
            |:||||.|||:||.:.||:.|.|||..::
Mouse   798 ELSKGQAKKLKKLFEAQEKLYKEYLQMLQ 826

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CysRSNP_611087.1 PTZ00399 2..737 CDD:240402 441/741 (60%)
CysRS_core 21..437 CDD:173899 276/417 (66%)
CarsNP_038770.3 GST_C_CysRS_N 4..76 CDD:198343
PTZ00399 91..827 CDD:240402 441/745 (59%)
CysRS_core 113..528 CDD:173899 276/417 (66%)
'HIGH' region 140..150 10/10 (100%)
'KMSKS' region 489..493 4/4 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C136023402
eggNOG 1 0.900 E1_COG0215
Hieranoid 1 1.000
Homologene 1 1.000 H1328
Inparanoid 1 1.050 866 1.000 Inparanoid score I411
Isobase 1 0.950 0 Normalized mean entropy S696
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004329
OrthoInspector 1 1.000 T1083173
orthoMCL 1 0.900 OOG5_126755
Panther 1 1.100 LDO PTHR10890
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1431
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.