DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CysRS and SPAC29E6.06c

Sequence 1:NP_611087.1 Gene:CysRS FlyBaseID:FBgn0027091 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_594564.1 Gene:SPAC29E6.06c PomBaseID:SPAC29E6.06c Length:754 Species:Schizosaccharomyces pombe

Alignment Length:787 Identity:343/788 (44%)
Similarity:458/788 (58%) Gaps:85/788 (11%)


  Fly     1 MSKR--GQPAWQAPEAVDRPKLKLFNSLTRQKEDFVPLDGNNVTWYSCGPTVYDASHMGHARSYI 63
            ||.|  .|..|..|:. .|.:|.::|:||..|..||. :|:|:|||.|||||||||||||||:|:
pombe     1 MSTRNPAQSHWGVPKG-QRTELYVYNTLTHSKVPFVS-NGSNLTWYCCGPTVYDASHMGHARNYV 63

  Fly    64 SFDILRRILSDYFGYNIHYVMNITDIDDKIIRRARQNHLFDEYAAEAQKLPLDELLGQQKEVLQR 128
            :.|||||||..||||||.:|.|:||||||||.||||.:||:||   .::...::...:.:|.:..
pombe    64 TTDILRRILQSYFGYNITFVQNVTDIDDKIILRARQQYLFEEY---KKQQGTNKSHSEAREKVTE 125

  Fly   129 FQDTCAKNTDPDKKIMLDK-----------TLQRMNDA----VEALTKAVGKGDEREISE-KRLL 177
            .....||...|:....:.:           ||...|..    |:||..|:   |..::|| ..::
pombe   126 AWFAYAKKNLPEPPSSMSEWPQWLASHDIPTLAINNPKLPMHVDALKSAL---DALQVSEASEII 187

  Fly   178 YLN----EAKDPISDWLDSLKGAQINDNAVFEALPRYWEDQFHNDMKSLNILPPDVLTRVSEYVP 238
            .|:    :.:|.:...||:..|:.:.|.|:|..|..||||.|:.||.:||:|||..:||||||||
pombe   188 SLDGFWPKVQDVLVPLLDAELGSTVTDPAIFRKLAAYWEDDFNKDMANLNVLPPTAVTRVSEYVP 252

  Fly   239 QIVTFIQKIIDNGLAY-AANNSVYFDVNGFDKREKHHYAKLVPEAYGDTKSLQEGEGDLSIAEDR 302
            :||.|:|:|||.|.|| ..:.|||||...|:| ..|.||||.|...|:.:.:.||||.|:    .
pombe   253 EIVDFVQRIIDRGYAYPVTDGSVYFDTEAFEK-GGHFYAKLEPWNKGNRELIAEGEGSLA----A 312

  Fly   303 LSEKRSANDFALWKASKAGEPWWDSPWGKGRPGWHIECSAMASDIFGPTFDIHTGGVDLKFPHHD 367
            |:.|:...|||||||||.|||.|||||.|||||||||||.|||.:.|...|||:||:||.|||||
pombe   313 LTGKKRPGDFALWKASKPGEPSWDSPWSKGRPGWHIECSVMASALLGSNIDIHSGGIDLAFPHHD 377

  Fly   368 NELAQSEAAFNESEWVKYFLHTGHLTIAGCKMSKSLKNFVTIQEALKKHSATQLRLAFLLHSWKD 432
            ||||||||.|:..:||.||.|.|||.|.|.|||||||||:||:|.|||.:..||||||||..|..
pombe   378 NELAQSEAYFDCPQWVNYFFHAGHLHIEGQKMSKSLKNFITIKEILKKFTPRQLRLAFLLQQWNT 442

  Fly   433 TLDYSENTMEMATQYEKFLNEFFLNVKDLTR----------HVLSEEPRRQFDAWTEVEAALQKK 487
            .||:.|..:......|:.|..||..|:.|..          ||    |.: ||   ::|..|.:|
pombe   443 QLDFKETLLAYVLNIEQALENFFRTVRALMNETEGVSANGGHV----PEK-FD---KLEIELLEK 499

  Fly   488 FSNAQVQVHASLCDNIDTRSALDAIRELVSVSNVYIRDNKTRLNSLLLRNVATYITDLLHVFGA- 551
            |...|...|.:|||:.:|...:..|..||:.:|:|||:...:..|.||..:|::||.:|.:||. 
pombe   500 FQQTQQNTHLALCDSFNTPLVMQHIDNLVTQANIYIREVGQQPCSRLLGQIASWITSMLQIFGLD 564

  Fly   552 ISGPRGGIGFPVSGGSGAQAAGADLETTVLPYVQSLAEFRYLVREQ--AKTLKAFDILKLCDDLR 614
            .:|....:|:..|.||.::      .|..:||:::::.||..|||.  ||. .:.:|||.||..|
pombe   565 ENGHPNAVGWSSSKGSSSE------NTDAMPYIRAVSSFRDRVRELCIAKA-SSQEILKACDIFR 622

  Fly   615 DNVLPNLGVRLEDKDIGKYAVKLVDRDSLLREREAKLAAEAEKAAEKERKKQAAAEAAAAKEAQR 679
            |..:..|||...|:..|...|||||.:.|:..||.||        |:||.|||....|.|::.::
pombe   623 DYDMAALGVSFNDRPQGSALVKLVDAEELIAAREQKL--------EEERAKQAKKAQAKAEQEKK 679

  Fly   680 RV--------NPKEMFLAETEKYSAFDENGLPT--HDKEGKE--VSKGQIKKLQKLQQQQEQRYN 732
            :|        :|.|||....| |.:|||.||||  ..::|.|  |.|.:.|||||...|||:.:.
pombe   680 QVERVMKGKTSPSEMFKMFKE-YLSFDEAGLPTKMRGEDGSEIDVPKSRKKKLQKEYAQQEKLHK 743

  Fly   733 EYLASIE 739
            |||:.||
pombe   744 EYLSYIE 750

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CysRSNP_611087.1 PTZ00399 2..737 CDD:240402 340/783 (43%)
CysRS_core 21..437 CDD:173899 221/437 (51%)
SPAC29E6.06cNP_594564.1 PTZ00399 1..747 CDD:240402 341/783 (44%)
CysRS_core 22..446 CDD:173899 221/436 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H1328
Inparanoid 1 1.050 555 1.000 Inparanoid score I188
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004329
OrthoInspector 1 1.000 T1124748
orthoMCL 1 0.900 OOG5_126755
Panther 1 1.100 LDO PTHR10890
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1431
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.