DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CysRS and cars-1

Sequence 1:NP_611087.1 Gene:CysRS FlyBaseID:FBgn0027091 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_491013.1 Gene:cars-1 WormBaseID:WBGene00000800 Length:909 Species:Caenorhabditis elegans

Alignment Length:747 Identity:373/748 (50%)
Similarity:498/748 (67%) Gaps:19/748 (3%)


  Fly     3 KRGQPAWQAPE-AVDRPKLKLFNSLTRQKEDFVPLDGNNVTWYSCGPTVYDASHMGHARSYISFD 66
            ||.|..|..|: |...|:|.::||||||||.|||.:|..|.||.|||||||:|||||||||:|.|
 Worm   166 KRVQKHWDQPKNATPPPQLTVYNSLTRQKEVFVPNEGKRVRWYICGPTVYDSSHMGHARSYLSLD 230

  Fly    67 ILRRILSDYFGYNIHYVMNITDIDDKIIRRARQNHLFDEYAAEAQKLPLDELLGQQKEVLQRFQD 131
            ||||:..|||||::.::|||||:|||||:||||:||...|..|:|..|:.::.......|:.|:.
 Worm   231 ILRRVFRDYFGYDVEFIMNITDVDDKIIKRARQSHLLKSYFNESQAPPVMKVCEDVVAALEHFKT 295

  Fly   132 TCAKNTDPDKKIMLDKTLQRMNDAVEALTKAVGKGDEREISEKRLLYLNEAKDPISDWLDSLKGA 196
            ......|||||.|.:..::::.....||.:|:...|.....|.:...|||::|.:|:|||...|.
 Worm   296 KFETEMDPDKKKMFEVMIKKVQQQSSALEEAMKAQDSIATEEAKGRLLNESRDVLSEWLDHNHGK 360

  Fly   197 QINDNAVFEALPRYWEDQFHNDMKSLNILPPDVLTRVSEYVPQIVTFIQKIIDNGLAYAA-NNSV 260
            .:.|::||:.|.:.:|.:|..||..||:||.|||||||||||:::|:::|||.||.|||| :.||
 Worm   361 DVRDHSVFDDLAKTYEKEFLADMARLNVLPVDVLTRVSEYVPEVITYVKKIISNGYAYAAEDGSV 425

  Fly   261 YFDVNGFDKREKHHYAKLVPEAYGD-----TKSLQEGEGDLSIAEDRLSEKRSANDFALWKASKA 320
            |||...|::..||.||||||||||:     .|:::|.||:||:::|||..|||.|||||||:||.
 Worm   426 YFDTKAFEQNPKHFYAKLVPEAYGEDSEQLLKNMKESEGELSMSDDRLKSKRSPNDFALWKSSKD 490

  Fly   321 GEPWWDSPWGKGRPGWHIECSAMASDIFGPTFDIHTGGVDLKFPHHDNELAQSEAAFNESEWVKY 385
            |||:|.|.||.||||||||||.|:|.|.|...|||.||.||||||||||:||.||.:::..||.|
 Worm   491 GEPFWPSEWGNGRPGWHIECSVMSSAICGSKLDIHAGGFDLKFPHHDNEIAQVEAHYDDPHWVNY 555

  Fly   386 FLHTGHLTIAGCKMSKSLKNFVTIQEALKKHSATQLRLAFLLHSWKDTLDYSENTMEMATQYEKF 450
            |||.|.|.|.|.|||||||||:||::||:.::..||||.||:|:|.|.||||.:|||.|.|:||.
 Worm   556 FLHCGTLRIQGMKMSKSLKNFITIRKALEDYTPRQLRLLFLMHNWADVLDYSSSTMERALQFEKI 620

  Fly   451 LNEFFLNVKDLTRHVLSEEPRRQFDAWTEVEAALQKKFSNAQVQVHASLCDNIDTRSALDAIREL 515
            .|||||.|||..|.....:....:..:...|..|.::|...:.:||.:|||::||||.::..|||
 Worm   621 TNEFFLLVKDFLRRHYKPDRSEGYQKFQGKELKLMEEFGKLKSEVHEALCDSVDTRSVIEKFREL 685

  Fly   516 VSVSNVYIRDNKTR---LNSLLLRNVATYITDLLHVFGAISGPRGGIGFPVS----GGSGAQAAG 573
            :|:.|.||.:.:..   .|.|||||:|.|||:||.:||||......||| ||    .|.|| :..
 Worm   686 ISLGNAYIVEKEKEGHVPNCLLLRNIAAYITNLLKIFGAIPQSNQEIGF-VSEDECNGEGA-STS 748

  Fly   574 ADLETTVLPYVQSLAEFRYLVREQAKTLKAFDILKLCDDLRDNVLPNLGVRLEDKDIGKYAVKLV 638
            .:.|..|:||:.:||:||..||..||..|...||:.||.|||..|..|||||||:: |:..||||
 Worm   749 FNKEAVVMPYLDALAQFREKVRLIAKEHKVNGILEECDTLRDKTLTELGVRLEDRN-GQTVVKLV 812

  Fly   639 DRDSLLREREAKLAAEAEKAAEKERKKQAAAEAAAAKEAQRRVNPKEMFL--AETEKYSAFDENG 701
            ||.:||||:|.|...:..|..||..|:|.|.|.|..:.|.:::.|:|:|.  ....|||.|||.|
 Worm   813 DRATLLREQEQKDTEKKRKDKEKADKEQKAREKADKEAAAKKIKPEELFKQGEHVGKYSKFDERG 877

  Fly   702 LPTHDKEGKEVSKGQIKKLQKLQQQQEQRYNE 733
            :|||..:|.|::|.|||||:|:.:.|:::|.:
 Worm   878 VPTHLADGTEITKSQIKKLEKVYEAQKKKYQQ 909

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CysRSNP_611087.1 PTZ00399 2..737 CDD:240402 373/748 (50%)
CysRS_core 21..437 CDD:173899 231/422 (55%)
cars-1NP_491013.1 PTZ00399 171..909 CDD:240402 370/741 (50%)
CysRS_core 185..607 CDD:173899 231/422 (55%)
nt_trans 375..>422 CDD:294020 29/47 (62%)
Anticodon_Ia_like <651..732 CDD:299868 35/81 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C136030875
eggNOG 1 0.900 E1_COG0215
Hieranoid 1 1.000
Homologene 1 1.000 H1328
Inparanoid 1 1.050 715 1.000 Inparanoid score I331
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D480663at33208
OrthoFinder 1 1.000 FOG0004329
OrthoInspector 1 1.000 T475870
orthoMCL 1 0.900 OOG5_126755
Panther 1 1.100 LDO PTHR10890
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1431
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.