DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CysRS and cars2

Sequence 1:NP_611087.1 Gene:CysRS FlyBaseID:FBgn0027091 Length:741 Species:Drosophila melanogaster
Sequence 2:XP_002933053.1 Gene:cars2 ID: Length:572 Species:Xenopus tropicalis

Alignment Length:669 Identity:219/670 (33%)
Similarity:312/670 (47%) Gaps:176/670 (26%)


  Fly     7 PA--WQAPEAVDRPKLKLFNSLTRQKEDFVPLDGNNVTWYSCGPTVYDASHMGHARSYISFDILR 69
            ||  |..|...| ..:|::|||||:|:..:..|....|||||||||||.:|:|||.||:.|||:|
 Frog    41 PAGCWAPPSGHD-TGIKVYNSLTRRKDPLILADPTVATWYSCGPTVYDHAHLGHACSYVRFDIIR 104

  Fly    70 RILSDYFGYNIHYVMNITDIDDKIIRRARQNHLFDEYAAEAQKLPLDELLGQQKEVLQRFQDTCA 134
            |||...||.:...||.:||||||||:||::.::                                
 Frog   105 RILLKVFGIDTVVVMVVTDIDDKIIKRAKELNI-------------------------------- 137

  Fly   135 KNTDPDKKIMLDKTLQRMNDAVEALTKAVGKGDEREISEKRLLYLNEAKDPISDWLDSLKGAQIN 199
                                                             .|:             
 Frog   138 -------------------------------------------------SPV------------- 140

  Fly   200 DNAVFEALPRYWEDQFHNDMKSLNILPPDVLTRVSEYVPQIVTFIQKIIDNGLAYA-ANNSVYFD 263
                  ||.|.:|..|..||.:|.:|||.|..||:|.:|||::||:.||.||.||| :..:||||
 Frog   141 ------ALARTYEQDFKQDMTALKVLPPTVYMRVTENIPQIISFIEHIIANGYAYATSQGNVYFD 199

  Fly   264 VNGFDKREKHHYAKLVPEAYGDTKSLQEGEGDLSIAEDRLSEKRSANDFALWKASKAGEPWWDSP 328
            |....:|    |.|. .:::.||.|           |....:||...||||||.||..||:|.||
 Frog   200 VQSIGER----YGKF-NDSFSDTAS-----------ESASQDKRHIRDFALWKTSKPEEPYWASP 248

  Fly   329 WGKGRPGWHIECSAMASDIFGPTFDIHTGGVDLKFPHHDNELAQSEAAFNESEWVKYFLHTGHLT 393
            |||||||||||||.:||.:||...||||||:||.||||:||:||.||....::|..||||||||.
 Frog   249 WGKGRPGWHIECSTIASSVFGKHLDIHTGGIDLAFPHHENEIAQCEAYHQSTQWGNYFLHTGHLH 313

  Fly   394 IAGC--KMSKSLKNFVTIQEALKKHSATQLRLAFLLHSWKDTLDYSENTMEMATQYEKFLNEFFL 456
            :.|.  ||||||:|:||::|.||..|..|.|:..|...:|..::||..:|..|......::.|..
 Frog   314 LKGNEEKMSKSLRNYVTVKEFLKSFSPDQFRMFCLRSKYKSAVEYSNGSMHDAVNTLHTISSFVD 378

  Fly   457 NVKDLTRHVLSEEPRRQFDAWTEVEAALQKKFSNAQVQVHASLCDNIDTRSALDAIRELVSVSNV 521
            :.|...:..|..:|.:        ||.|.::.:..:|.|.|:..|:.||..|:||:.:|:...|.
 Frog   379 DAKAYMKGQLICQPVQ--------EALLWQRLNETKVNVKAAFSDDFDTPRAVDAVMDLIHHGNR 435

  Fly   522 YI----RDNKTRLNSLLLRNVATYITDLLHVFGAISGPRGGIGFPVSGGSGAQAAGADLETTVL- 581
            .:    :::.:..:|::...:.:||...|.:.|.             ..|..|.|..|..:.|| 
 Frog   436 QLKAVSKESNSPRSSVVYGAMISYIEQFLEILGI-------------SLSQNQVAAEDRHSAVLF 487

  Fly   582 PYVQSLAEFRYLVREQAKT------------------------LKAFDILKLCDDLRDNVLPNLG 622
            ..|:.:..||..||..|..                        |:...:|:.||.:|.: |...|
 Frog   488 NVVEEMISFRSKVRNYALAADESPNAIGQEEKQQYKERRRQLLLEREPLLQACDIMRQH-LAVYG 551

  Fly   623 VRLEDKDIGKYAV-KLVDR 640
            :.::|:  |..:. :|:||
 Frog   552 INVKDR--GNTSTWELLDR 568

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CysRSNP_611087.1 PTZ00399 2..737 CDD:240402 219/670 (33%)
CysRS_core 21..437 CDD:173899 164/419 (39%)
cars2XP_002933053.1 CysS 54..566 CDD:223293 212/652 (33%)
CysRS_core 56..359 CDD:173899 164/419 (39%)
Anticodon_Ia_like 408..469 CDD:299868 15/61 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D480663at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.