DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8414 and Nol9

Sequence 1:NP_611084.2 Gene:CG8414 FlyBaseID:FBgn0034073 Length:995 Species:Drosophila melanogaster
Sequence 2:XP_006539271.1 Gene:Nol9 MGIID:1921285 Length:715 Species:Mus musculus

Alignment Length:586 Identity:130/587 (22%)
Similarity:244/587 (42%) Gaps:131/587 (22%)


  Fly   468 LKSNHVLAVIK--EDLEVYGTLVLTLLCGQISVNGYRARR----QEAITIYSPKGL--NWVSIS- 523
            |.|..||.::.  |.....|...:|.:.||:.|.|:...:    |:..::|:...|  |.|..: 
Mouse   138 LGSGRVLMMLPPGEGFTFSGICRVTCVYGQLEVYGHIINQGQPPQDVFSVYTHSYLTINGVPYAE 202

  Fly   524 PTKTKKPVKDEV-------------NW--------------EELNKNFTRAQLDRIKTSFQRQTN 561
            |.|::|.::.|:             ||              |.:...|    :|.:||   .:.:
Mouse   203 PEKSEKAIRREIRALLKPYTKLDDRNWVVRYFPPLGSIMILERMQSRF----VDFLKT---YKCS 260

  Fly   562 AIVLLHRNTSAQQLVDTFGKHMAQNVFPLVNS---SNRPFG---QSETLLHCLIQSSDQSRTLQV 620
            :.|||..|...:                 |||   :.:..|   |......||    .:|....:
Mouse   261 SYVLLQENAPVR-----------------VNSEFTTLKKIGIRRQKRKKAICL----SESGLCAL 304

  Fly   621 PQVWNKLQMHATSRIIVAGGKGVGKSSLLRYLINRNLGQFPSMLLIDLDIGQPEIFVPQTISCTV 685
            .::.:...:.....|::.|...:|||:..|.|||:.|...|.:..::.|:||.|...|..::...
Mouse   305 EELVSVSCVDGCPVILLCGACDIGKSTFNRILINQLLNSIPGVDYLECDLGQTEFTPPGCVALLT 369

  Fly   686 IDEPLLGPGFLYNRQPEHAIVVGHTNIVLCAEQYARAVIQLVQNIQNDAKYSNIPWLINTMGYNK 750
            |.||||||.:.:.|:|:..:..|..|   |...|.. .|.:|:.:..|.| ...|.:|||||:..
Mouse   370 ITEPLLGPPYTHQRKPQRMVYYGKMN---CYNDYEN-YIDIVKYVFRDYK-REFPLIINTMGWVS 429

  Fly   751 GFGIELMALLVDRIRPTDLVQIAS------PIPINNF----DSVLDRNSLSQIK---------PI 796
            ..|:.|:..|:..:.|..:||:.|      |...:.:    |.:..::.:.:.:         .:
Mouse   430 DNGLRLLVDLIRVLSPNYVVQLYSDRCKFTPTLTSEYVELTDGLYTKSKIKRYRGFEIPEFGDNL 494

  Fly   797 IYSAEEFKINEIPKYTLHKL-------ISAVPAREKGTWSLSAKDMRYSNLLARLSSCLTGNAKS 854
            .::.||.:.:.:|.:|.|.|       :|:...:.:..::...:|:.....|::|...:..:...
Mouse   495 EFTYEEKESSPLPVFTGHVLLSVHSEFLSSKNEKNRAKYNRIFRDLAVLGYLSQLMLPVPESLSP 559

  Fly   855 LTDCQPLGV--SLESLKILH----PTSKNYSREELIRGMEANVVYLCH-------HGAG------ 900
            |....|..|  |..::::||    ||       .::..:.|:.|.||.       :..|      
Mouse   560 LHSLTPYQVPFSAVAIRVLHADVAPT-------HILYAVNASWVGLCRIVDDMKGYTRGPILLAQ 617

  Fly   901 --LPQCLGIGVVRAIDYERKELYLVPAMPLQKMSLVDCLILGGEQSLPQGFLRDQGQGVSSSVPF 963
              :..|||.|:.|.||.:::..:::..:|.:::..|:||:: |..|:|....::| .|...|||:
Mouse   618 NPICDCLGFGICRGIDMDKRTYHILTPLPPEELKTVNCLLV-GSISIPHCIFQNQ-PGPEGSVPY 680

  Fly   964 V 964
            |
Mouse   681 V 681

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8414NP_611084.2 HC2 41..>163 CDD:284736
RNA_pol_3_Rpc31 <255..333 CDD:288542
P-loop_NTPase 639..824 CDD:304359 54/211 (26%)
Nol9XP_006539271.1 Grc3 317..663 CDD:224260 84/359 (23%)
CLP1_P 323..>455 CDD:293183 45/137 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C284712618
eggNOG 1 0.900 E1_COG1341
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003713
OrthoInspector 1 1.000 T1082307
orthoMCL 1 0.900 OOG5_129564
Panther 1 1.100 LDO PTHR12755
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R523
TreeFam 1 0.960
98.730

Return to query results.
Submit another query.