DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8414 and SPCC830.03

Sequence 1:NP_611084.2 Gene:CG8414 FlyBaseID:FBgn0034073 Length:995 Species:Drosophila melanogaster
Sequence 2:NP_588473.1 Gene:SPCC830.03 PomBaseID:SPCC830.03 Length:736 Species:Schizosaccharomyces pombe

Alignment Length:824 Identity:176/825 (21%)
Similarity:307/825 (37%) Gaps:261/825 (32%)


  Fly   268 VRKIKVFKSAQEETDSDEDDIDYEPEDSDDFGSEEFDSEESDSEDTSSADYDSDGDFYSEYSDME 332
            ||::.:.|:|:::.:|.              |.:...||| :|:|....:..::|:|.|      
pombe    19 VRQLTLSKAARKKDNSS--------------GKKRSVSEE-ESQDKYEDEMKTEGEFPS------ 62

  Fly   333 DVSDSDSEEFGSDIFDTDDLDSTYEPPDIEGFFDHPPVGMQREPLIIEEIFDDPPVEKKQERIEQ 397
                                            :.|         .:::.:.  |.|:.:.:...:
pombe    63 --------------------------------YKH---------TLVQVVV--PGVDHRTKLHSE 84

  Fly   398 SSVMDIVVK---NLSSVPPKKESEVAIETEENDEVSLPEVVTPE--KENYLQPSDVPFYRNPQAN 457
            ||..|..:.   |.|.|.|::.||.::.:.:....|||..:..|  .||      ||  .:||::
pombe    85 SSKNDSEITPDINRSKVNPQEYSEFSVASPQTISPSLPLNLDDETVSEN------VP--HSPQSS 141

  Fly   458 PTELSVF----ENSLKSNHVLAV-IKED--LEVYGTLVLTLLCGQISVNGYRARRQEAITIYSPK 515
            ...:.|.    |||.:....|.| :.:|  |.:.||.:...:.|:..:.|         ..||..
pombe   142 NDAIPVIKITEENSFRVKDTLYVGLHKDQKLAMVGTFIFRSVRGKFQLFG---------ATYSSA 197

  Fly   516 GLNWVSI-SPTKTKKPVKDEVN----------WEE--LN-KNFTRAQLDRIKTSFQRQT------ 560
            .::|..: :|.....||...::          :||  || ::|........:..::.:.      
pombe   198 CMSWFPLNAPLAFATPVFSAIDNALPAMQISEYEEDSLNLRSFAVPSYSPKEHEYELEPKDILPN 262

  Fly   561 -NAIVLLHRNTSAQQLVDTFGKHMAQNVFPLVNSSNRPFGQSETLLHCLIQSSDQSRTLQV-PQV 623
             ..::....|.:        |......|.|.   :.|.|    :..:.|..:|..|...:: |:.
pombe   263 FETVIAFRENEN--------GLSKIARVLPF---AKRLF----SFKNLLQDASSISNNFEITPES 312

  Fly   624 W----NKLQMHATS-------RIIVAGGKGVGKSSLLRYLINRNLGQFPSMLLIDLDIGQPEIFV 677
            |    |:| :.:||       |::|.|.||.||||..||:.||.|.|:..:..:|||.||||:..
pombe   313 WCSFSNQL-LFSTSKSDYVVPRLMVCGPKGSGKSSFSRYITNRLLQQYRHIAYLDLDPGQPEVVP 376

  Fly   678 PQTISCTVIDEPLLGPGF---LY--------------NRQPEHAIVVGHTNIVLCAEQYARAVIQ 725
            ...||...|:.||.||.|   |:              .:.|:|.|.        |..:.......
pombe   377 SGHISLYYINSPLQGPVFARMLFPTYMLRLHLGDISPQKDPDHYIA--------CVTRLFAEYKD 433

  Fly   726 LVQNIQNDAKYSNIPWLINTMGYNKGFGIELMALLVDRIRPTDLVQIASPIPINNFDSVLDRNSL 790
            .:.| |..::...||.:||..|:.:|.|.||::.:||..:||::|.::..          |..|.
pombe   434 YIFN-QEISQKEIIPLIINCPGWIRGGGAELLSSIVDICQPTEVVYMSRE----------DMKSS 487

  Fly   791 SQIKPIIYSAEEFK---INEIPKYTLHKLISAVPAREKGTW---------SLSAKDMRYSNLLAR 843
            .:.|..||..:|:.   ::...::.|..|        :.||         .:::.|.|...||:.
pombe   488 HREKKSIYQHKEYMPDFLSSRDEFQLTLL--------ESTWQYLPDPNVNKVTSADNRMLGLLSY 544

  Fly   844 L-SSCLTGNAK------SLTDCQPLGVSLESLKILHPTSKNYSREELIRGMEANV---------- 891
            | .:|   |.:      |||.|||:..:.:.      :||......:| |...||          
pombe   545 LYFNC---NLQRWDFTTSLTACQPIATAFKG------SSKGIDAVNII-GEPLNVNDVAKTINGT 599

  Fly   892 ---VYLCHHGA----------------------GLP------QCLGIGVVRAIDYERKELYLVPA 925
               :|.|...:                      |||      .|||:.|:|.||.:|.|.:.|..
pombe   600 LMALYACDTASLDNSNTQRIVSSPEGIPLIINDGLPLDPNTSHCLGLIVLRTIDLKRNEFHFVGP 664

  Fly   926 MPLQKM-----SLVDCLILGGEQSLPQGFLRDQGQGVSSSVPFV 964
            :.|:.:     ..:..::..|...||...:.|......|.:|::
pombe   665 LNLELIKDAYAKSLKIVLERGRLELPVYAMLDHRLAQYSELPYL 708

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8414NP_611084.2 HC2 41..>163 CDD:284736
RNA_pol_3_Rpc31 <255..333 CDD:288542 14/65 (22%)
P-loop_NTPase 639..824 CDD:304359 57/205 (28%)
SPCC830.03NP_588473.1 Grc3 245..713 CDD:224260 117/518 (23%)
CLP1_P 338..>483 CDD:293183 49/164 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003713
OrthoInspector 1 1.000 T1124262
orthoMCL 1 0.900 OOG5_129564
Panther 1 1.100 LDO PTHR12755
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R523
TreeFam 1 0.960
76.900

Return to query results.
Submit another query.