DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8414 and nol-9

Sequence 1:NP_611084.2 Gene:CG8414 FlyBaseID:FBgn0034073 Length:995 Species:Drosophila melanogaster
Sequence 2:NP_001255744.1 Gene:nol-9 WormBaseID:WBGene00010709 Length:549 Species:Caenorhabditis elegans

Alignment Length:559 Identity:117/560 (21%)
Similarity:209/560 (37%) Gaps:110/560 (20%)


  Fly   470 SNHVLAVIK--EDLEVYGTLVLTLLCGQISVNGYRARRQEAITIYSPKGLNWVSIS-PTKTKKPV 531
            ||..:.|::  |.|.::|:.....|.|..|:|.|.      :...|.:..|::.|| |.:...|.
 Worm    12 SNLEIYVVQPGERLSIFGSCSFLCLAGNASINDYN------LPAVSCESSNFMKISAPQRMDVPA 70

  Fly   532 KDEVNWEELNKNFTRAQLD-RIKTSFQRQTNAIVLLHRNTSA-----QQLVDTFGKHMAQNVFP- 589
            ..:|  .:...::..|:|. |:|....:....|:.:...|..     .:::| |.:.....|.. 
 Worm    71 ILQV--FKSGPSYKHARLKFRLKEVAPKNYEKIMEMIGTTEPSVFIFSKILD-FAEETVSGVVSN 132

  Fly   590 -LVNSSNRPFGQSETLL--HCLIQSSD-----QSRTLQVPQVWNKLQM----HATSRIIVAGGKG 642
             |::||.    |.:.:|  |..|...|     |.:..|:....|:|..    ...:.|:..|.||
 Worm   133 FLIHSSI----QKQIILPPHFFISRDDFIIYPQQQEAQLKSQMNRLNKLRNDGQRTTILPIGHKG 193

  Fly   643 VGKSSLLRYLINRNLGQ-FPSMLLIDLDIGQPEIFVPQTISCTVIDEPLLGPGFLYNRQP-EHAI 705
            .|||:|:|.|:||.|.. :..:.::|.||||.|......:|.|.:..|:||....:.|.. |::.
 Worm   194 AGKSNLMRSLVNRCLSNGYEHVYVLDCDIGQSEFTPCGCLSLTKVTSPILGKPHGHQRASFENSF 258

  Fly   706 VVGHTNIVLCAEQYARAVIQLVQNIQNDAKYSNIP---WLINTMGYNKGFGIELMALLVDRIRPT 767
            ..|...:     :.....:.:.:.:.|..|..:.|   .:||:||:....|.|::..:.....|.
 Worm   259 FYGDITV-----RDINLYMDIFERLFNKFKVISEPGSVCIINSMGWVTDEGAEILDGITRVTDPE 318

  Fly   768 DLVQIASPIPINNFDSVLDRNSLSQIKPIIYSAEE-----FKINEIPKYTLHKLISAVPAREKGT 827
            ..|:|.             |:........:..||.     |..|.|.       :..:|.:::  
 Worm   319 LFVEIF-------------RDQTEARYQFLNRAEHNIVEIFANNSIG-------VIGLPPQKR-- 361

  Fly   828 WSLSAKDMRYSNLLARLSSCL-TGNAKSLTDCQPLGVSLESLKILHPTSKNYSREELIRGMEANV 891
              |.|..:|...::...||.| ..:..|.....|..:..|::.|..|.........:...:...:
 Worm   362 --LPAALIRELTIVGYFSSRLPRPSLASFPKVAPYKLRFENVTICVPVDLLVEDSHVFSSINTQI 424

  Fly   892 VYLCHHGAGLP-----------------------QCLGIGVVRAIDYERKELYLVPAMPLQKMSL 933
            :.||.:...|.                       ||:|.|::|.:..|.:.:::|..:.|.|:..
 Worm   425 MALCINNTDLKPRKLYGKDDLPSICVIDGNSPALQCIGFGIIRGVSVEERIIFVVTPVDLLKLEE 489

  Fly   934 VDCLILGGEQSLPQGF------------LRDQGQGVSSS 960
            ...|:.|.....|..|            |.|..||.|.:
 Worm   490 PPVLVRGMRIQTPTMFYTADPYNRCPYVLNDLEQGNSDN 528

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8414NP_611084.2 HC2 41..>163 CDD:284736
RNA_pol_3_Rpc31 <255..333 CDD:288542
P-loop_NTPase 639..824 CDD:304359 45/195 (23%)
nol-9NP_001255744.1 CLP1_P 190..376 CDD:293183 48/215 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C284218632
eggNOG 1 0.900 E1_COG1341
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003713
OrthoInspector 1 1.000 T474573
orthoMCL 1 0.900 OOG5_129564
Panther 1 1.100 LDO PTHR12755
Phylome 1 0.910 0.765 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R523
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.