DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8399 and AIR12

DIOPT Version :9

Sequence 1:NP_001286472.1 Gene:CG8399 / 36768 FlyBaseID:FBgn0034067 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_566306.3 Gene:AIR12 / 819927 AraportID:AT3G07390 Length:273 Species:Arabidopsis thaliana


Alignment Length:153 Identity:37/153 - (24%)
Similarity:58/153 - (37%) Gaps:43/153 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LAVAIWPDPGQS---------LPQGAPETVCDTMLPFHSGGSVLPQNSVSPFSVETSSSTLGQGQ 74
            |:||....|.|:         .|.|.........|.:.|||...|  .|..::: :|.|:|.:|:
plant    85 LSVAFVATPSQANGGWVAWAINPTGTKMAGSQAFLAYRSGGGAAP--VVKTYNI-SSYSSLVEGK 146

  Fly    75 ------TLRVD-LTG----------VPAGL-------SFGGYMIQARNRNPPHQIIGQFGPARDG 115
                  .||.: |:|          ||||.       ..||.:...|....|      |||...|
plant   147 LAFDFWNLRAESLSGGRIAIFTTVKVPAGADSVNQVWQIGGNVTNGRPGVHP------FGPDNLG 205

  Fly   116 TIKLMN-CENSVNNSATHSNAGP 137
            :.:::: .|::...||....:.|
plant   206 SHRVLSFTEDAAPGSAPSPGSAP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8399NP_001286472.1 Reeler 40..170 CDD:280232 30/123 (24%)
DOMON_SDR_2_like 223..392 CDD:187686
Cyt_b561_FRRS1_like 358..553 CDD:176490
AIR12NP_566306.3 DOMON_CIL1_like 61..213 CDD:187687 33/136 (24%)
PHA03185 <182..246 CDD:177553 12/53 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D599276at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.