DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8399 and AIR12

DIOPT Version :8

Sequence 1:NP_001286472.1 Gene:CG8399 / 36768 FlyBaseID:FBgn0034067 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_566306.3 Gene:AIR12 / 819927 AraportID:AT3G07390 Length:273 Species:Arabidopsis thaliana

Alignment Length:153 Identity:37/153 - (24%)
Similarity:58/153 - (37%) Gaps:43/153 - (28%)


  Fly    19 LAVAIWPDPGQS---------LPQGAPETVCDTMLPFHSGGSVLPQNSVSPFSVETSSSTLGQGQ 74
            |:||....|.|:         .|.|.........|.:.|||...|  .|..::: :|.|:|.:|:
plant    85 LSVAFVATPSQANGGWVAWAINPTGTKMAGSQAFLAYRSGGGAAP--VVKTYNI-SSYSSLVEGK 146

  Fly    75 ------TLRVD-LTG----------VPAGL-------SFGGYMIQARNRNPPHQIIGQFGPARDG 115
                  .||.: |:|          ||||.       ..||.:...|....|      |||...|
plant   147 LAFDFWNLRAESLSGGRIAIFTTVKVPAGADSVNQVWQIGGNVTNGRPGVHP------FGPDNLG 205

  Fly   116 TIKLMN-CENSVNNSATHSNAGP 137
            :.:::: .|::...||....:.|
plant   206 SHRVLSFTEDAAPGSAPSPGSAP 228

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8399NP_001286472.1 Reeler 40..170 CDD:280232 30/123 (24%)
DOMON_SDR_2_like 223..392 CDD:187686
Cyt_b561_FRRS1_like 358..553 CDD:176490
AIR12NP_566306.3 DOMON_CIL1_like 61..213 CDD:187687 33/136 (24%)
PHA03185 <182..246 CDD:177553 12/53 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D599276at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.