DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8399 and FRRS1

DIOPT Version :8

Sequence 1:NP_001286472.1 Gene:CG8399 / 36768 FlyBaseID:FBgn0034067 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_001013682.2 Gene:FRRS1 / 391059 HGNCID:27622 Length:626 Species:Homo sapiens

Alignment Length:597 Identity:179/597 - (29%)
Similarity:274/597 - (45%) Gaps:77/597 - (12%)


  Fly    13 TLVTALLAVAIWPDPGQSLPQGAPETVCDTMLPFHSGGSVLPQNSVSPFSVETSSSTLGQGQTLR 77
            ||.|.:|.:.|  ....:.|.|.....|..|:|.| |.|  || ||....:..|..|...|..:.
Human     7 TLGTCILLLHI--SYVANYPNGKVTQSCHGMIPEH-GHS--PQ-SVPVHDIYVSQMTFRPGDQIE 65

  Fly    78 VDLTGVPAGLSFGGYMIQARN----RNPPHQIIGQFGPARDGTIKLMNCENSVNNSATHSNAGPK 138
            |.|:|.|    |.|::::|||    ..||   ||.|........:|:.||:...::.:|.:|..|
Human    66 VTLSGHP----FKGFLLEARNAEDLNGPP---IGSFTLIDSEVSQLLTCEDIQGSAVSHRSASKK 123

  Fly   139 QQVILEWQSPVDFLGQVVFNATIAQSYNEFWVGVPSQPVQIVRRDLSAAPPLPTQSPSAPAGTTR 203
            .::.:.|.:|........|..|:.:.|..:||.:|.              |:.:|..:.|..|.:
Human   124 TEIKVYWNAPSSAPNHTQFLVTVVEKYKIYWVKIPG--------------PIISQPNAFPFTTPK 174

  Fly   204 APYVPPSYVAPNNVVAVSSDPI-YNGCGQSKNCFGFPDGCVATKSCTSITVVTVRGDVFEFEIQS 267
            |..||...:.|   |:..:.|. .:.||..|.|...|..|...|..:.:.:...|.|  :..:..
Human   175 ATVVPLPTLPP---VSHLTKPFSASDCGNKKFCIRSPLNCDPEKEASCVFLSFTRDD--QSVMVE 234

  Fly   268 GKGTNAAYVAVGLSDDAKMGDDLTTECVPENGRVNLY-SSLTSAS-PYSAVRSNVNQNSARLLDA 330
            ..|.:..|::..||.|..||||....|:.|:..|.:. |.||..| |....|..:...:.||   
Human   235 MSGPSKGYLSFALSHDQWMGDDDAYLCIHEDQTVYIQPSHLTGRSHPVMDSRDTLEDMAWRL--- 296

  Fly   331 SIVDGVIYCRVQRD-AVTNVQGRTFDLRNGKYHLLVASGSSLKENSVGYHDIGRL--PSAQPINL 392
              .|||:.|..:|: .:..|:.| ||| |..|::.:|.|::         :.||:  .|.||:..
Human   297 --ADGVMQCSFRRNITLPGVKNR-FDL-NTSYYIFLADGAA---------NDGRIYKHSQQPLIT 348

  Fly   393 AEVQDLSGS--------SRLLIQLHGAFMIAAWIGTTSLGIIFARYFKQTWVGSQSCGTDQWFAW 449
            .|..|::.|        |.||:::|||.|..||:.|.|:|::.||:||..|..:...|...||..
Human   349 YEKYDVTDSPKNIGGSHSVLLLKVHGALMFVAWMTTVSIGVLVARFFKPVWSKAFLLGEAAWFQV 413

  Fly   450 HRLLMVTTWSLTVAAYVLIWVELKQAVW--HA--HSIIGLITVILCFIQPIGALFRPGPNDKKRP 510
            ||:||.||..||..|:|:.::  .:..|  ||  |..:|.|.:.|..:||:.|:|||..:|.:|.
Human   414 HRMLMFTTTVLTCIAFVMPFI--YRGGWSRHAGYHPYLGCIVMTLAVLQPLLAVFRPPLHDPRRQ 476

  Fly   511 YFNWGHWLGGNLAHILGIVTIFFSVKLPKAELPE-WMDWILVSFVVVHVLVHLIFSIGLCLNHWQ 574
            .|||.||..|..|.|:.:..:|..:.||...||: |..:.:..||..||...::    |.|.:|.
Human   477 MFNWTHWSMGTAARIIAVAAMFLGMDLPGLNLPDSWKTYAMTGFVAWHVGTEVV----LELKYWM 537

  Fly   575 IGGMASERHLSQ 586
            :....|..||.|
Human   538 MTEFRSFSHLLQ 549

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8399NP_001286472.1 Reeler 40..170 CDD:280232 38/133 (29%)
DOMON_SDR_2_like 223..392 CDD:187686 49/174 (28%)
Cyt_b561_FRRS1_like 358..553 CDD:176490 71/209 (34%)
FRRS1NP_001013682.2 Reeler 32..155 CDD:307916 38/133 (29%)
DOMON_SDR_2_like 192..354 CDD:187686 50/179 (28%)
Cyt_b561_FRRS1_like 320..533 CDD:176490 77/228 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110129707
eggNOG 1 0.900 E1_KOG4293
Hieranoid 1 1.000
Homologene 1 1.000 H40653
Inparanoid 1 1.050 211 1.000 Inparanoid score I3606
Isobase 1 0.950 0 Normalized mean entropy S7160
OMA 1 1.010
OrthoDB 1 1.010 D464310at33208
OrthoFinder 1 1.000 FOG0001122
OrthoInspector 1 1.000 T1073308
orthoMCL 1 0.900 OOG5_132388
Panther 1 1.100 O PTHR45828
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3670
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.