DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8399 and l(2)34Fc

Sequence 1:NP_001286472.1 Gene:CG8399 FlyBaseID:FBgn0034067 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_001285930.1 Gene:l(2)34Fc FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster

Alignment Length:169 Identity:45/170 (26%)
Similarity:83/170 (49%) Gaps:19/170 (11%)


  Fly    14 LVTALLAVAIWPDPGQSLPQGAPETVCDTMLPFHSGGSVLPQNSVSPFSVETSSSTLGQGQTLRV 78
            ::.|.||:::     .:...|||:..|..:.|.|  |:.| |.:..|:|: :..|.:...|.|.:
  Fly     6 VLAACLAISV-----HAYSDGAPKAACRDLTPQH--GAKL-QVTKPPYSI-SGPSHVRSDQKLTL 61

  Fly    79 DLTGVPAGLSFGGYMIQARNRNPPHQIIGQFGPARDGTIKLMNCENSVNNSATHSNA---GPKQQ 140
            .|    .|..|.|:|||||:..  ::::|||........:.::|... :::.||.:|   .|...
  Fly    62 TL----GGDEFLGFMIQARDGQ--NRVVGQFQVVDSVHSQTLDCSGK-DDTITHLSAQKGKPLTG 119

  Fly   141 VILEWQSPVDFLGQVVFNATIAQSYNEFWVGVPSQPVQI 179
            :..:|..|..:.|.|.|.||:.|:...:|||..::.:.:
  Fly   120 ITFDWIPPAGYKGNVKFMATVVQTGFVYWVGRVTKDIDV 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8399NP_001286472.1 Reeler 40..170 CDD:280232 37/133 (28%)
DOMON_SDR_2_like 223..392 CDD:187686
Cyt_b561_FRRS1_like 358..553 CDD:176490
l(2)34FcNP_001285930.1 Reeler 27..149 CDD:280232 37/133 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131171086
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S7160
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001122
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45828
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3670
55.010

Return to query results.
Submit another query.